StarFunc result for job id O15144

User Input

>input (300 residues)
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15144	1.000	1.000	6.652E-56	300	1.000	1.000	O15144.pdb.gz	ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1
2	AFDB:B5DGD5	0.991	0.994	2.613E-52	299	0.880	0.883	B5DGD5.pdb.gz	B5DGD5_SALSA Arp2/3 complex 34 kDa subunit OS=Salmo salar OX=8030 GN=arpc2 PE=2 SV=1
3	PDB:1k8kD	0.943	0.996	1.480E-49	284	0.943	0.996	1k8kD.pdb.gz
4	AFDB:Q9VIM5	0.966	0.963	7.594E-47	301	0.750	0.748	Q9VIM5.pdb.gz	ARPC2_DROME Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Arpc2 PE=2 SV=2
5	AFDB:Q8WTM6	0.963	0.960	1.285E-44	301	0.707	0.704	Q8WTM6.pdb.gz	ARPC2_CAEEL Probable actin-related protein 2/3 complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=arx-4 PE=1 SV=1
6	AFDB:O14241	0.924	0.875	3.804E-34	317	0.487	0.461	O14241.pdb.gz	ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arc2 PE=1 SV=1
7	AFDB:O96623	0.866	0.886	3.818E-30	293	0.403	0.413	O96623.pdb.gz	ARPC2_DICDI Actin-related protein 2/3 complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=arcB PE=1 SV=1
8	PDB:6w17D	0.868	0.866	3.553E-27	301	0.457	0.455	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
9	PDB:3dwlD	0.826	0.908	1.264E-26	272	0.440	0.485	3dwlD.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
10	AFDB:P53731	0.840	0.742	2.120E-25	342	0.377	0.330	P53731.pdb.gz	ARPC2_YEAST Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARC35 PE=1 SV=1
11	AFDB:Q8LGI3	0.847	0.802	8.116E-20	318	0.277	0.261	Q8LGI3.pdb.gz	ARC2A_ARATH Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana OX=3702 GN=ARPC2A PE=1 SV=1
12	AFDB:F4IVU1	0.789	0.644	2.447E-19	374	0.287	0.230	F4IVU1.pdb.gz	ARC2B_ARATH Actin-related protein 2/3 complex subunit 2B OS=Arabidopsis thaliana OX=3702 GN=ARPC2B PE=2 SV=1
13	AFDB:O96625	0.367	0.607	3.052E-4	169	0.090	0.160	O96625.pdb.gz	ARPC4_DICDI Actin-related protein 2/3 complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=arcD PE=1 SV=1
14	PDB:4xeiF	0.338	0.572	4.718E-4	168	0.083	0.149	4xeiF.pdb.gz
15	PDB:6w17F	0.354	0.600	1.774E-3	168	0.097	0.173	6w17F.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
16	PDB:3i82A	0.162	0.201	5.970E-3	216	0.080	0.111	3i82A.pdb.gz
17	PDB:5xqiB	0.132	0.142	1.902E-2	276	0.090	0.098	5xqiB.pdb.gz
18	PDB:3kxyA	0.222	0.404	2.244E-2	133	0.053	0.120	3kxyA.pdb.gz
19	PDB:5xqiC	0.124	0.141	4.351E-2	254	0.083	0.098	5xqiC.pdb.gz
20	PDB:7ajuJJ	0.211	0.287	6.766E-2	199	0.100	0.151	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DGD5	0.0	565	299	0.880	0.883	B5DGD5_SALSA Arp2/3 complex 34 kDa subunit OS=Salmo salar OX=8030 GN=arpc2 PE=2 SV=1
2	O15144	0.0	622	300	1.000	1.000	ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1
3	P85970	0.0	615	300	0.990	0.990	ARPC2_RAT Actin-related protein 2/3 complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Arpc2 PE=1 SV=1
4	Q3MHR7	0.0	620	300	0.997	0.997	ARPC2_BOVIN Actin-related protein 2/3 complex subunit 2 OS=Bos taurus OX=9913 GN=ARPC2 PE=1 SV=1
5	Q53R19	0.0	622	300	1.000	1.000	Q53R19_HUMAN Arp2/3 complex 34 kDa subunit OS=Homo sapiens OX=9606 GN=ARPC2 PE=2 SV=1
6	Q6IRB1	0.0	584	300	0.920	0.920	ARC2B_XENLA Actin-related protein 2/3 complex subunit 2-B OS=Xenopus laevis OX=8355 GN=arpc2-b PE=1 SV=1
7	Q9CVB6	0.0	618	300	0.993	0.993	ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus OX=10090 GN=Arpc2 PE=1 SV=3
8	Q9VIM5	1.42e-174	486	301	0.750	0.748	ARPC2_DROME Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Arpc2 PE=2 SV=2
9	Q8WTM6	1.14e-157	443	301	0.707	0.704	ARPC2_CAEEL Probable actin-related protein 2/3 complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=arx-4 PE=1 SV=1
10	O14241	5.59e-89	270	317	0.487	0.461	ARPC2_SCHPO Actin-related protein 2/3 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arc2 PE=1 SV=1
11	O96623	6.66e-69	218	293	0.403	0.413	ARPC2_DICDI Actin-related protein 2/3 complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=arcB PE=1 SV=1
12	P53731	6.53e-51	173	342	0.400	0.351	ARPC2_YEAST Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARC35 PE=1 SV=1
13	Q8LGI3	2.60e-34	129	318	0.277	0.261	ARC2A_ARATH Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana OX=3702 GN=ARPC2A PE=1 SV=1
14	F4IVU1	2.96e-25	105	374	0.297	0.238	ARC2B_ARATH Actin-related protein 2/3 complex subunit 2B OS=Arabidopsis thaliana OX=3702 GN=ARPC2B PE=2 SV=1
15	G3XCV7	4.0	31.6	646	0.073	0.034	G3XCV7_PSEAE Peptidoglycan D,D-transpeptidase MrdA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pbpA PE=1 SV=1
16	Q9VU08	5.6	31.2	3919	0.067	0.005	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
17	Q9VFE2	6.5	30.8	868	0.090	0.031	Q9VFE2_DROME FI18055p1 OS=Drosophila melanogaster OX=7227 GN=Sdr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05856 ARPC4	75	14.4	ARP2/3 complex 20 kDa subunit (ARPC4)
2	PF04045 P34-Arc	8e-100	345.1	Arp2/3 complex, 34 kD subunit p34-Arc
3	PF09336 Vps4_C	67	14.9	Vps4 C terminal oligomerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008568952.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008566162.1	0.999	Actin-related protein 2/3 complex subunit 5
2	482537.XP_008568667.1	0.999	Actin-related protein 2/3 complex subunit 3
3	482537.XP_008569000.1	0.999	Neural Wiskott-Aldrich syndrome protein
4	482537.XP_008575707.1	0.999	Actin-related protein 2/3 complex subunit 4
5	482537.XP_008576861.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 83% coverage of the annotated genomic feature by RNAseq alignments
6	482537.XP_008584402.1	0.999	Actin-related protein 2 isoform X1
7	482537.XP_008584702.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 25 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008584704.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 29 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008563086.1	0.996	Actin-related protein 2/3 complex subunit 5-like protein
10	482537.XP_008576028.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008579917.1	0.995	Actin-related protein 3
12	482537.XP_008569666.1	0.991	wiskott-Aldrich syndrome protein
13	482537.XP_008569748.1	0.957	wiskott-Aldrich syndrome protein family member 1
14	482537.XP_008563969.1	0.937	NCK-interacting protein with SH3 domain isoform X1
15	482537.XP_008584583.1	0.937	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 19 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008590060.1	0.917	Protein BRICK1
17	482537.XP_008567052.1	0.906	Actin, cytoplasmic 2
18	482537.XP_008574178.1	0.906	Actin, cytoplasmic 1
19	482537.XP_008577687.1	0.898	Abl interactor 1-like
20	482537.XP_008579810.1	0.898	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 31 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	0.996	actin filament binding
GO:0005200	0.343	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0071840	0.987	cellular component organization or biogenesis
GO:0051128	0.986	regulation of cellular component organization
GO:0044087	0.985	regulation of cellular component biogenesis
GO:0016043	0.982	cellular component organization
GO:0048522	0.979	positive regulation of cellular process
GO:0051130	0.974	positive regulation of cellular component organization
GO:0043254	0.939	regulation of protein-containing complex assembly
GO:0044089	0.939	positive regulation of cellular component biogenesis
GO:0110053	0.915	regulation of actin filament organization
GO:0030832	0.906	regulation of actin filament length
GO:0008064	0.879	regulation of actin polymerization or depolymerization
GO:0030029	0.768	actin filament-based process
GO:0031344	0.753	regulation of cell projection organization
GO:0030036	0.739	actin cytoskeleton organization
GO:0120035	0.703	regulation of plasma membrane bounded cell projection organization
GO:0032271	0.690	regulation of protein polymerization
GO:0050896	0.629	response to stimulus
GO:0051495	0.624	positive regulation of cytoskeleton organization
GO:1902743	0.506	regulation of lamellipodium organization
GO:0030833	0.424	regulation of actin filament polymerization
GO:0051716	0.389	cellular response to stimulus
GO:0120032	0.387	regulation of plasma membrane bounded cell projection assembly
GO:0031346	0.376	positive regulation of cell projection organization
GO:0031334	0.347	positive regulation of protein-containing complex assembly
GO:0007015	0.343	actin filament organization
GO:1902745	0.342	positive regulation of lamellipodium organization
GO:0048856	0.334	anatomical structure development
GO:0010591	0.332	regulation of lamellipodium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0005829	0.998	cytosol
GO:0031982	0.997	vesicle
GO:0015629	0.997	actin cytoskeleton
GO:0016020	0.996	membrane
GO:0005576	0.995	extracellular region
GO:0012505	0.991	endomembrane system
GO:0071944	0.990	cell periphery
GO:0005615	0.990	extracellular space
GO:0005886	0.977	plasma membrane
GO:0070013	0.976	intracellular organelle lumen
GO:0005885	0.944	Arp2/3 protein complex
GO:0005634	0.940	nucleus
GO:0043230	0.907	extracellular organelle
GO:0070062	0.900	extracellular exosome
GO:0030054	0.835	cell junction
GO:0031981	0.834	nuclear lumen
GO:0070161	0.801	anchoring junction
GO:0005654	0.778	nucleoplasm
GO:0005925	0.719	focal adhesion
GO:0031410	0.657	cytoplasmic vesicle
GO:0031252	0.655	cell leading edge
GO:0042995	0.638	cell projection
GO:0120025	0.631	plasma membrane bounded cell projection
GO:0030027	0.364	lamellipodium
GO:0098590	0.326	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]