StarFunc result for job id O15146

User Input

>input (869 residues)
MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPV
PTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELK
VVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLAVKELFCAKEWLVMEEKTHRG
LYRSEMHLLSVPECSKLPSMHWDPTACARLPHLDYNKENLKTFPPMTSSKPSVDIPNLPS
SSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESAAVTLTTLP
SELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPY
EPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAY
GDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERK
FVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYT
TESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWS
KLPADRPSFTSIHRILERMCERAEGTVSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IZ74	0.532	0.498	0.000	941	0.628	0.580	A0A0R4IZ74.pdb.gz
2	AFDB:O15146	1.000	1.000	0.000	869	1.000	1.000	O15146.pdb.gz	MUSK_HUMAN Muscle, skeletal receptor tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MUSK PE=1 SV=1
3	AFDB:Q7ZZ92	0.367	0.573	2.803E-64	553	0.402	0.631	Q7ZZ92.pdb.gz
4	AFDB:Q6PA07	0.313	0.262	8.618E-55	1043	0.228	0.190	Q6PA07.pdb.gz	Q6PA07_XENLA MGC68806 protein OS=Xenopus laevis OX=8355 GN=ptk7.L PE=1 SV=1
5	AFDB:Q13308	0.306	0.250	1.706E-54	1070	0.239	0.194	Q13308.pdb.gz	PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2
6	AFDB:E7F2R9	0.308	0.254	9.306E-52	1061	0.214	0.175	E7F2R9.pdb.gz
7	AFDB:A0A024R230	0.334	0.346	6.264E-49	838	0.257	0.266	A0A024R230.pdb.gz
8	AFDB:Q91987	0.333	0.353	3.027E-48	818	0.246	0.262	Q91987.pdb.gz	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
9	AFDB:A0A0R4ITE7	0.331	0.350	2.347E-47	821	0.231	0.245	A0A0R4ITE7.pdb.gz
10	AFDB:P22455	0.333	0.359	3.217E-47	802	0.255	0.277	P22455.pdb.gz	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
11	PDB:4fl2A	0.282	0.432	9.734E-22	555	0.114	0.178	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2h8hA	0.260	0.490	2.255E-21	445	0.112	0.218	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4k2rA	0.274	0.424	2.396E-20	551	0.119	0.187	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.275	0.532	2.828E-19	441	0.107	0.211	1k9aB.pdb.gz
15	PDB:6dldD	0.169	0.449	7.796E-17	269	0.075	0.242	6dldD.pdb.gz
16	PDB:6dlfA	0.187	0.554	1.904E-16	236	0.070	0.258	6dlfA.pdb.gz
17	PDB:5oj2B	0.159	0.196	5.828E-14	692	0.089	0.111	5oj2B.pdb.gz
18	PDB:3eqdA	0.259	0.657	7.191E-14	315	0.083	0.229	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:6s73A	0.276	0.827	1.154E-13	269	0.077	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:8dksA	0.235	0.677	2.406E-13	283	0.086	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15146	0.0	1803	869	1.000	1.000	MUSK_HUMAN Muscle, skeletal receptor tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MUSK PE=1 SV=1
2	Q5J1R8	0.0	601	676	0.414	0.533	Q5J1R8_DANRE Muscle, skeletal receptor tyrosine-protein kinase isoform 2 precursor OS=Danio rerio OX=7955 GN=si:dz57f23.3 PE=2 SV=1
3	Q5J1R9	0.0	939	941	0.606	0.560	Q5J1R9_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fj98e12 PE=1 SV=1
4	Q61006	0.0	1670	868	0.931	0.932	MUSK_MOUSE Muscle, skeletal receptor tyrosine-protein kinase OS=Mus musculus OX=10090 GN=Musk PE=1 SV=1
5	Q62838	0.0	1677	868	0.934	0.935	MUSK_RAT Muscle, skeletal receptor tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Musk PE=1 SV=1
6	Q9V6K3	1.76e-121	386	724	0.211	0.253	ROR2_DROME Tyrosine-protein kinase transmembrane receptor Ror2 OS=Drosophila melanogaster OX=7227 GN=Nrk PE=1 SV=2
7	Q8JFU3	9.32e-92	295	351	0.167	0.413	Q8JFU3_DANRE Muscle, skeletal receptor tyrosine-protein kinase isoform 3 precursor OS=Danio rerio OX=7955 GN=fj98e12 PE=4 SV=2
8	A0A0R4ILA2	1.22e-89	303	799	0.173	0.188	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
9	Q6B515	1.68e-89	300	669	0.165	0.214	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
10	P15209	2.12e-89	303	821	0.168	0.178	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
11	Q63604	5.65e-89	302	821	0.167	0.177	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
12	Q16620	1.75e-88	301	822	0.167	0.176	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
13	Q548C2	1.75e-88	301	822	0.167	0.176	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
14	F7DGW1	2.01e-88	301	838	0.167	0.173	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
15	A1L4F5	3.46e-88	302	943	0.242	0.223	A1L4F5_HUMAN Receptor tyrosine kinase-like orphan receptor 2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=1
16	Q01974	3.53e-88	302	943	0.242	0.223	ROR2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=2
17	Q91987	7.17e-88	299	818	0.166	0.176	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
18	Q01973	1.90e-87	300	937	0.255	0.237	ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens OX=9606 GN=ROR1 PE=1 SV=2
19	P04629	5.14e-87	296	796	0.165	0.180	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
20	Q9Z139	1.09e-86	298	937	0.257	0.238	ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus OX=10090 GN=Ror1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.7e+02	13.4	Adenovirus E3 region protein CR1
2	PF08205 C2-set_2	3.2e-07	41.6	CD80-like C2-set immunoglobulin domain
3	PF06365 CD34_antigen	5.9	18.0	CD34/Podocalyxin family
4	PF01392 Fz	1.6e-13	62.6	Fz domain
5	PF12330 Haspin_kinase	86	13.5	Haspin like kinase domain
6	PF07679 I-set	2.1e-48	173.6	Immunoglobulin I-set domain
7	PF00047 ig	2.1e-19	80.8	Immunoglobulin domain
8	PF13895 Ig_2	2.3e-25	100.0	Immunoglobulin domain
9	PF13927 Ig_3	4.8e-42	153.7	Immunoglobulin domain
10	PF16680 Ig_4	6.2	18.8	T-cell surface glycoprotein CD3 delta chain
11	PF18452 Ig_6	3.6	18.9	Immunoglobulin domain
12	PF16706 Izumo-Ig	2.6e+02	13.0	Izumo-like Immunoglobulin domain
13	PF00069 Pkinase	7.3e-37	138.8	Protein kinase domain
14	PF07714 PK_Tyr_Ser-Thr	8e-91	315.5	Protein tyrosine and serine/threonine kinase
15	PF13908 Shisa	61	15.1	Wnt and FGF inhibitory regulator
16	PF07686 V-set	1.3e-06	40.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298854	0.999	43 kDa receptor-associated protein of the synapse
2	9606.ENSP00000368678	0.999	Agrin
3	9606.ENSP00000344432	0.997	Protein Dok-7
4	9606.ENSP00000367888	0.995	Low-density lipoprotein receptor-related protein 4
5	9606.ENSP00000373298	0.990	Acetylcholinesterase collagenic tail peptide
6	9606.ENSP00000368169	0.982	Segment polarity protein dishevelled homolog DVL-1
7	9606.ENSP00000304290	0.964	Acetylcholine receptor subunit beta
8	9606.ENSP00000374145	0.961	Acetylcholine receptor subunit gamma
9	9606.ENSP00000356224	0.940	Nesprin-1
10	9606.ENSP00000383118	0.932	Cell division control protein 42 homolog
11	9606.ENSP00000278568	0.920	Serine/threonine-protein kinase PAK 1
12	9606.ENSP00000314067	0.915	Serine/threonine-protein kinase PAK 2
13	9606.ENSP00000353864	0.915	Serine/threonine-protein kinase PAK 3
14	9606.ENSP00000348461	0.914	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000362680	0.913	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000341189	0.905	Focal adhesion kinase 1
17	9606.ENSP00000367686	0.904	Serine/threonine-protein kinase PAK 5
18	9606.ENSP00000380638	0.904	Protein-tyrosine kinase 2-beta
19	9606.ENSP00000469413	0.904	Serine/threonine-protein kinase PAK 4
20	9606.ENSP00000258385	0.869	Acetylcholine receptor subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004672	0.996	protein kinase activity
GO:0004713	0.920	protein tyrosine kinase activity
GO:0038023	0.795	signaling receptor activity
GO:0042802	0.767	identical protein binding
GO:0005102	0.452	signaling receptor binding
GO:0004888	0.376	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0050808	0.977	synapse organization
GO:0048518	0.963	positive regulation of biological process
GO:0050793	0.949	regulation of developmental process
GO:0048522	0.949	positive regulation of cellular process
GO:0007528	0.946	neuromuscular junction development
GO:0051174	0.940	regulation of phosphorus metabolic process
GO:0010562	0.927	positive regulation of phosphorus metabolic process
GO:0031401	0.923	positive regulation of protein modification process
GO:0042325	0.922	regulation of phosphorylation
GO:0042327	0.906	positive regulation of phosphorylation
GO:0032501	0.900	multicellular organismal process
GO:0001932	0.885	regulation of protein phosphorylation
GO:0051716	0.848	cellular response to stimulus
GO:0001934	0.834	positive regulation of protein phosphorylation
GO:0040008	0.824	regulation of growth
GO:0072657	0.814	protein localization to membrane
GO:0032502	0.812	developmental process
GO:0007154	0.790	cell communication
GO:0051128	0.790	regulation of cellular component organization
GO:0043113	0.789	receptor clustering
GO:0048856	0.780	anatomical structure development
GO:0050803	0.772	regulation of synapse structure or activity
GO:0007165	0.767	signal transduction
GO:0048731	0.722	system development
GO:0007166	0.698	cell surface receptor signaling pathway
GO:0008152	0.605	metabolic process
GO:0071704	0.513	organic substance metabolic process
GO:0048519	0.471	negative regulation of biological process
GO:0048523	0.448	negative regulation of cellular process
GO:0023051	0.444	regulation of signaling
GO:0010646	0.441	regulation of cell communication
GO:0048583	0.417	regulation of response to stimulus
GO:0044237	0.413	cellular metabolic process
GO:0006807	0.406	nitrogen compound metabolic process
GO:0044238	0.402	primary metabolic process
GO:0007167	0.359	enzyme-linked receptor protein signaling pathway
GO:0009966	0.339	regulation of signal transduction
GO:0043170	0.327	macromolecule metabolic process
GO:0030154	0.321	cell differentiation
GO:1901564	0.316	organonitrogen compound metabolic process
GO:0051239	0.300	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.998	cell junction
GO:0045202	0.966	synapse
GO:0032991	0.964	protein-containing complex
GO:0005622	0.856	intracellular anatomical structure
GO:0098794	0.848	postsynapse
GO:0043227	0.828	membrane-bounded organelle
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0005737	0.665	cytoplasm
GO:0098590	0.645	plasma membrane region
GO:0097060	0.610	synaptic membrane
GO:0045211	0.600	postsynaptic membrane
GO:0043235	0.575	receptor complex
GO:0031594	0.571	neuromuscular junction
GO:0009986	0.373	cell surface
GO:0042995	0.305	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.920	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]