StarFunc result for job id O15151

User Input

>input (490 residues)
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP
DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLVIKVFIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15151	1.000	1.000	5.169E-82	490	1.000	1.000	O15151.pdb.gz	MDM4_HUMAN Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2
2	AFDB:O35618	0.345	0.345	1.478E-68	489	0.841	0.843	O35618.pdb.gz	MDM4_MOUSE Protein Mdm4 OS=Mus musculus OX=10090 GN=Mdm4 PE=1 SV=2
3	AFDB:P23804	0.219	0.220	6.749E-29	489	0.306	0.307	P23804.pdb.gz	MDM2_MOUSE E3 ubiquitin-protein ligase Mdm2 OS=Mus musculus OX=10090 GN=Mdm2 PE=1 SV=3
4	AFDB:O42354	0.223	0.243	4.845E-27	445	0.290	0.319	O42354.pdb.gz	MDM2_DANRE E3 ubiquitin-protein ligase Mdm2 OS=Danio rerio OX=7955 GN=mdm2 PE=1 SV=1
5	PDB:7vdvY	0.158	0.306	1.687E-3	245	0.045	0.090	7vdvY.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
6	PDB:6v8oM	0.149	0.230	2.084E-2	310	0.029	0.045	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
7	PDB:6tdaO	0.135	0.296	3.235E-2	212	0.031	0.071	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:5dkaA	0.089	0.362	1.289E-1	96	0.029	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
9	PDB:5oa30	0.148	0.152	1.373E-1	479	0.022	0.023	5oa30.pdb.gz	Structural and Functional Insights into Human Re-initiation Complexes.
10	PDB:3jb9U	0.089	0.100	3.108E-1	430	0.020	0.023	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
11	AFDB:B7Z143	0.115	0.093	4.125E-1	630	0.104	0.081	B7Z143.pdb.gz	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
12	PDB:5gmkq	0.095	0.118	7.493E-1	387	0.016	0.021	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
13	PDB:5gm6a	0.097	0.340	7.979E-1	123	0.035	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7egmH	0.144	0.179	9.048E-1	388	0.027	0.034	7egmH.pdb.gz
15	AFDB:M9PHN7	0.119	0.103	9.944E-1	585	0.106	0.089	M9PHN7.pdb.gz	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
16	PDB:7jzvA	0.102	0.179	1.026	253	0.029	0.055	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	AFDB:Q54Z52	0.097	0.068	1.128	822	0.104	0.062	Q54Z52.pdb.gz	Q54Z52_DICDI Prespore-specific protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277777 PE=4 SV=1
18	AFDB:Q9LE42	0.069	0.027	2.251	1670	0.120	0.035	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
19	AFDB:A9LS46	0.073	0.055	2.553	690	0.120	0.086	A9LS46.pdb.gz	WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1
20	AFDB:Q6S7F2	0.082	0.052	2.553	904	0.112	0.061	Q6S7F2.pdb.gz	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZ58	0.0	762	392	0.755	0.944	A0A087WZ58_HUMAN MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
2	O15151	0.0	1018	490	1.000	1.000	MDM4_HUMAN Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2
3	O35618	0.0	804	489	0.841	0.843	MDM4_MOUSE Protein Mdm4 OS=Mus musculus OX=10090 GN=Mdm4 PE=1 SV=2
4	A0A087WTR9	1.98e-160	457	267	0.443	0.813	A0A087WTR9_HUMAN MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
5	Q5T0Y3	1.21e-114	337	171	0.349	1.000	Q5T0Y3_HUMAN MDM4 regulator of p53 (Fragment) OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
6	Q00987	1.43e-60	208	491	0.304	0.303	MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 OS=Homo sapiens OX=9606 GN=MDM2 PE=1 SV=1
7	A0A8I6G5V3	6.36e-57	198	477	0.314	0.323	A0A8I6G5V3_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=3 SV=1
8	O42354	6.31e-55	192	445	0.298	0.328	MDM2_DANRE E3 ubiquitin-protein ligase Mdm2 OS=Danio rerio OX=7955 GN=mdm2 PE=1 SV=1
9	P23804	1.22e-53	189	489	0.300	0.301	MDM2_MOUSE E3 ubiquitin-protein ligase Mdm2 OS=Mus musculus OX=10090 GN=Mdm2 PE=1 SV=3
10	A0A0G2JVC1	8.41e-53	186	434	0.288	0.325	A0A0G2JVC1_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=1 SV=2
11	D3ZVH5	3.28e-51	182	458	0.284	0.303	D3ZVH5_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=1 SV=1
12	A0A8I6GK47	4.25e-49	177	468	0.288	0.301	A0A8I6GK47_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=3 SV=1
13	A7UKY0	7.49e-21	94.0	257	0.080	0.152	A7UKY0_HUMAN Mdm2 (Fragment) OS=Homo sapiens OX=9606 GN=mdm2 PE=1 SV=1
14	F4ISV9	3.56e-05	48.5	399	0.039	0.048	APD4_ARATH E3 ubiquitin-protein ligase APD4 OS=Arabidopsis thaliana OX=3702 GN=APD4 PE=2 SV=1
15	F4IS08	9.25e-05	47.4	447	0.051	0.056	F4IS08_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=APD1 PE=1 SV=1
16	Q0WS06	9.75e-05	47.0	441	0.051	0.057	APD1_ARATH E3 ubiquitin-protein ligase APD1 OS=Arabidopsis thaliana OX=3702 GN=APD1 PE=2 SV=1
17	B3H754	1.85e-04	46.2	404	0.037	0.045	APD3_ARATH E3 ubiquitin-protein ligase APD3 OS=Arabidopsis thaliana OX=3702 GN=APD3 PE=2 SV=1
18	F4IIX4	2.34e-04	46.2	652	0.035	0.026	F4IIX4_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EDA18 PE=4 SV=1
19	Q84ME1	0.001	43.1	378	0.049	0.063	LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana OX=3702 GN=LUL3 PE=1 SV=1
20	F7FLN8	0.002	42.7	602	0.061	0.050	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10235 Cript	33	16.5	Microtubule-associated protein CRIPT
2	PF14447 Prok-RING_4	0.84	20.9	Prokaryotic RING finger family 4
3	PF02201 SWIB	0.0012	30.0	SWIB/MDM2 domain
4	PF13920 zf-C3HC4_3	4.4e-08	44.2	Zinc finger, C3HC4 type (RING finger)
5	PF00641 zf-RanBP	2.9e-05	34.6	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.999	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
4	9606.ENSP00000421689	0.993	Casein kinase I isoform alpha
5	9606.ENSP00000441543	0.985	Polyubiquitin-C
6	9606.ENSP00000304697	0.982	Polyubiquitin-B
7	9606.ENSP00000278616	0.969	Serine-protein kinase ATM
8	9606.ENSP00000372023	0.966	Serine/threonine-protein kinase Chk2
9	9606.ENSP00000381717	0.965	Ubiquitin-conjugating enzyme E2 D2
10	9606.ENSP00000418915	0.964	Cyclin-dependent kinase inhibitor 2A
11	9606.ENSP00000306330	0.959	14-3-3 protein gamma
12	9606.ENSP00000361021	0.951	Phosphatase and tensin homolog
13	9606.ENSP00000272317	0.936	Ubiquitin-40S ribosomal protein S27a
14	9606.ENSP00000379441	0.922	Junction-mediating and -regulatory protein
15	9606.ENSP00000363377	0.908	Forkhead box protein O4
16	9606.ENSP00000388107	0.907	Ubiquitin-60S ribosomal protein L40
17	9606.ENSP00000342105	0.906	Dual specificity tyrosine-phosphorylation-regulated kinase 2
18	9606.ENSP00000363124	0.905	PHD finger protein 20
19	9606.ENSP00000367545	0.895	Tumor protein p73
20	9606.ENSP00000260187	0.889	Ubiquitin carboxyl-terminal hydrolase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019899	0.988	enzyme binding
GO:0043167	0.919	ion binding
GO:0046872	0.905	metal ion binding
GO:0008270	0.899	zinc ion binding
GO:0003824	0.571	catalytic activity
GO:0016740	0.564	transferase activity
GO:0140096	0.553	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0042127	0.979	regulation of cell population proliferation
GO:0019222	0.975	regulation of metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0048523	0.969	negative regulation of cellular process
GO:0050896	0.954	response to stimulus
GO:0051716	0.943	cellular response to stimulus
GO:0065008	0.936	regulation of biological quality
GO:0048518	0.927	positive regulation of biological process
GO:0048522	0.920	positive regulation of cellular process
GO:0010468	0.880	regulation of gene expression
GO:0007154	0.879	cell communication
GO:0051246	0.879	regulation of protein metabolic process
GO:0010556	0.871	regulation of macromolecule biosynthetic process
GO:0019219	0.870	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.869	regulation of cellular biosynthetic process
GO:0033554	0.862	cellular response to stress
GO:0031324	0.859	negative regulation of cellular metabolic process
GO:0010605	0.854	negative regulation of macromolecule metabolic process
GO:0051172	0.853	negative regulation of nitrogen compound metabolic process
GO:2001141	0.848	regulation of RNA biosynthetic process
GO:0007165	0.842	signal transduction
GO:0006355	0.842	regulation of DNA-templated transcription
GO:0071704	0.779	organic substance metabolic process
GO:0071840	0.768	cellular component organization or biogenesis
GO:0016043	0.759	cellular component organization
GO:0035556	0.737	intracellular signal transduction
GO:0006807	0.705	nitrogen compound metabolic process
GO:0006974	0.683	cellular response to DNA damage stimulus
GO:0044238	0.677	primary metabolic process
GO:0009894	0.599	regulation of catabolic process
GO:0006357	0.590	regulation of transcription by RNA polymerase II
GO:0043067	0.580	regulation of programmed cell death
GO:0042221	0.576	response to chemical
GO:0043170	0.557	macromolecule metabolic process
GO:0042981	0.533	regulation of apoptotic process
GO:0009893	0.527	positive regulation of metabolic process
GO:0048583	0.486	regulation of response to stimulus
GO:1901564	0.468	organonitrogen compound metabolic process
GO:0044237	0.465	cellular metabolic process
GO:0009966	0.456	regulation of signal transduction
GO:0010604	0.436	positive regulation of macromolecule metabolic process
GO:0043069	0.427	negative regulation of programmed cell death
GO:1902531	0.390	regulation of intracellular signal transduction
GO:0045934	0.389	negative regulation of nucleobase-containing compound metabolic process
GO:0019538	0.386	protein metabolic process
GO:0043066	0.385	negative regulation of apoptotic process
GO:0008285	0.368	negative regulation of cell population proliferation
GO:0032501	0.361	multicellular organismal process
GO:0009890	0.357	negative regulation of biosynthetic process
GO:0010558	0.351	negative regulation of macromolecule biosynthetic process
GO:0031327	0.351	negative regulation of cellular biosynthetic process
GO:0009628	0.344	response to abiotic stimulus
GO:0043412	0.333	macromolecule modification
GO:0042770	0.333	signal transduction in response to DNA damage
GO:0072331	0.329	signal transduction by p53 class mediator
GO:0070887	0.327	cellular response to chemical stimulus
GO:0051253	0.326	negative regulation of RNA metabolic process
GO:0045892	0.318	negative regulation of DNA-templated transcription
GO:0036211	0.306	protein modification process
GO:0065009	0.303	regulation of molecular function
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005737	0.818	cytoplasm
GO:0005667	0.728	transcription regulator complex
GO:0017053	0.723	transcription repressor complex
GO:0005829	0.460	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.564	Transferases.

[back to server]