StarFunc result for job id O15156

User Input

>input (539 residues)
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDS
PPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAG
RVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGK
LPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNH
MHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAS
PAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64321	0.531	0.527	1.285E-67	544	0.917	0.908	Q64321.pdb.gz	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
2	AFDB:A1YPR0	0.235	0.207	2.886E-23	619	0.390	0.339	A1YPR0.pdb.gz	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
3	AFDB:Q8BGV5	0.207	0.196	1.790E-13	572	0.167	0.157	Q8BGV5.pdb.gz	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
4	AFDB:Q7Z7K2	0.204	0.187	1.112E-12	595	0.182	0.165	Q7Z7K2.pdb.gz	ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens OX=9606 GN=ZNF467 PE=1 SV=1
5	AFDB:Q9Y2L8	0.236	0.158	1.480E-12	839	0.176	0.113	Q9Y2L8.pdb.gz	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
6	AFDB:O14978	0.206	0.165	1.756E-12	683	0.199	0.157	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
7	AFDB:Q811H0	0.150	0.191	2.935E-12	420	0.202	0.260	Q811H0.pdb.gz	ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus OX=10090 GN=Zbtb42 PE=1 SV=2
8	AFDB:M9PBR0	0.221	0.103	3.290E-12	1216	0.213	0.095	M9PBR0.pdb.gz	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
9	AFDB:P17029	0.198	0.190	5.823E-12	563	0.197	0.188	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
10	AFDB:M9NFP1	0.210	0.141	6.528E-12	825	0.178	0.116	M9NFP1.pdb.gz	M9NFP1_DROME Jim, isoform E OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
11	PDB:3w5kB	0.093	0.278	6.041E-4	110	0.069	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4z4kA	0.060	0.098	4.286E-1	282	0.022	0.043	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
13	PDB:5dkaA	0.050	0.150	5.702E-1	96	0.041	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7o4iW	0.058	0.087	9.002E-1	312	0.074	0.128	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:6o9lQ	0.050	0.060	1.342	430	0.056	0.070	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:6n7pB	0.069	0.155	3.161	195	0.032	0.087	6n7pB.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
17	PDB:3j6bW	0.039	0.129	3.346	112	0.028	0.134	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
18	PDB:5xbtA	0.058	0.095	3.971	271	0.033	0.066	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
19	PDB:7pzyO	0.074	0.171	4.205	150	0.030	0.107	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:5a4fL	0.051	0.049	5.283	581	0.015	0.014	5a4fL.pdb.gz	Mechanism of hydrogen activation by [NiFe] hydrogenases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15156	0.0	1093	539	1.000	1.000	ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZBTB7B PE=1 SV=2
2	Q64321	0.0	822	544	0.917	0.908	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
3	Q8VCZ7	3.23e-58	206	619	0.178	0.155	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
4	A1YPR0	7.16e-58	205	619	0.178	0.155	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
5	O95365	1.54e-55	198	584	0.174	0.161	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
6	O88939	3.71e-55	197	569	0.176	0.167	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
7	Q9QZ48	5.76e-55	196	569	0.176	0.167	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
8	O88282	7.24e-37	144	474	0.278	0.316	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1
9	Q8N143	2.77e-36	143	479	0.275	0.309	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
10	A8KA13	3.84e-36	142	480	0.275	0.308	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
11	Q80X44	3.25e-34	139	710	0.219	0.166	ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus OX=10090 GN=Zbtb24 PE=1 SV=1
12	O43167	1.57e-33	137	697	0.221	0.171	ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens OX=9606 GN=ZBTB24 PE=1 SV=2
13	P10074	7.55e-31	129	688	0.237	0.186	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
14	P13360	7.85e-27	117	604	0.087	0.078	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
15	Q811H0	3.33e-26	113	420	0.236	0.302	ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus OX=10090 GN=Zbtb42 PE=1 SV=2
16	Q923T4	6.88e-26	113	484	0.095	0.105	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
17	P07247	1.50e-25	112	502	0.108	0.116	KRUP_DROME Protein krueppel OS=Drosophila melanogaster OX=7227 GN=Kr PE=1 SV=2
18	Q6NX49	3.86e-25	112	715	0.100	0.076	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
19	Q8K3J5	5.54e-25	111	619	0.197	0.171	ZN131_MOUSE Zinc finger protein 131 OS=Mus musculus OX=10090 GN=Znf131 PE=1 SV=1
20	Q05516	7.09e-25	111	673	0.254	0.204	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.4e-29	113.9	BTB/POZ domain
2	PF11672 DUF3268	5.5e+02	12.3	zinc-finger-containing domain
3	PF09237 GAGA	8.6	17.8	GAGA factor
4	PF14446 Prok-RING_1	8e+02	11.4	Prokaryotic RING finger family 1
5	PF00096 zf-C2H2	1.6e-08	45.7	Zinc finger, C2H2 type
6	PF12756 zf-C2H2_2	83	14.9	C2H2 type zinc-finger (2 copies)
7	PF13894 zf-C2H2_4	6.5e-08	43.8	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	0.00042	31.7	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	5.6e-17	72.5	Zinc-finger double domain
10	PF12874 zf-met	0.55	21.9	Zinc-finger of C2H2 type
11	PF09723 Zn-ribbon_8	3.5e+02	12.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008968510.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008970070.1	0.690	CUB domain containing protein 1
2	9597.XP_008956304.1	0.681	Thymopoietin
3	9597.XP_003827854.1	0.673	GATA binding protein 3
4	9597.XP_008963889.1	0.617	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
5	9597.XP_008961409.1	0.596	Runt-related transcription factor 3 isoform X1
6	9597.XP_008967423.1	0.595	ETS translocation variant 2 isoform X1
7	9597.XP_003829165.1	0.578	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
8	9597.XP_003810677.1	0.548	NK2 homeobox 2
9	9597.XP_008976619.1	0.518	ETS variant 4
10	9597.XP_008958403.1	0.514	Belongs to the histone H2B family.
11	9597.XP_008975883.1	0.514	ETS proto-oncogene 2, transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.983	transcription regulator activity
GO:0000976	0.975	transcription cis-regulatory region binding
GO:0003700	0.969	DNA-binding transcription factor activity
GO:0000981	0.957	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.912	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.831	DNA-binding transcription repressor activity
GO:0000978	0.825	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042803	0.814	protein homodimerization activity
GO:0001216	0.660	DNA-binding transcription activator activity
GO:0001228	0.644	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.567	enzyme binding
GO:0042826	0.435	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0051252	0.970	regulation of RNA metabolic process
GO:0032502	0.954	developmental process
GO:0010556	0.945	regulation of macromolecule biosynthetic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0006355	0.944	regulation of DNA-templated transcription
GO:0048519	0.931	negative regulation of biological process
GO:0048523	0.916	negative regulation of cellular process
GO:0048856	0.906	anatomical structure development
GO:0048518	0.879	positive regulation of biological process
GO:0008152	0.875	metabolic process
GO:0048522	0.871	positive regulation of cellular process
GO:0050896	0.867	response to stimulus
GO:0071704	0.862	organic substance metabolic process
GO:0044238	0.845	primary metabolic process
GO:0009892	0.837	negative regulation of metabolic process
GO:0010605	0.834	negative regulation of macromolecule metabolic process
GO:0006807	0.832	nitrogen compound metabolic process
GO:0009893	0.825	positive regulation of metabolic process
GO:0051172	0.816	negative regulation of nitrogen compound metabolic process
GO:0010604	0.812	positive regulation of macromolecule metabolic process
GO:0006357	0.806	regulation of transcription by RNA polymerase II
GO:0031324	0.792	negative regulation of cellular metabolic process
GO:0051173	0.776	positive regulation of nitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0051253	0.724	negative regulation of RNA metabolic process
GO:0032501	0.721	multicellular organismal process
GO:0045892	0.714	negative regulation of DNA-templated transcription
GO:0045935	0.712	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.690	positive regulation of DNA-templated transcription
GO:0043170	0.637	macromolecule metabolic process
GO:0044237	0.631	cellular metabolic process
GO:0000122	0.575	negative regulation of transcription by RNA polymerase II
GO:0002376	0.536	immune system process
GO:0045944	0.536	positive regulation of transcription by RNA polymerase II
GO:0048583	0.517	regulation of response to stimulus
GO:0051239	0.459	regulation of multicellular organismal process
GO:0030154	0.458	cell differentiation
GO:0045321	0.420	leukocyte activation
GO:0051716	0.383	cellular response to stimulus
GO:0042127	0.365	regulation of cell population proliferation
GO:0002684	0.358	positive regulation of immune system process
GO:0048584	0.349	positive regulation of response to stimulus
GO:0051240	0.338	positive regulation of multicellular organismal process
GO:0042221	0.337	response to chemical
GO:0050793	0.300	regulation of developmental process
GO:0048468	0.300	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.519	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]