StarFunc result for job id O15164

User Input

>input (1050 residues)
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64127	0.536	0.536	0.000	1051	0.927	0.926	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
2	AFDB:Q99PP7	0.473	0.438	1.590E-87	1142	0.503	0.462	Q99PP7.pdb.gz	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
3	AFDB:Q9U3Y7	0.243	0.228	1.780E-46	1133	0.246	0.228	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
4	AFDB:Q924W6	0.198	0.172	7.572E-41	1242	0.290	0.246	Q924W6.pdb.gz	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
5	PDB:7z36B	0.213	0.471	3.669E-19	446	0.100	0.235	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
6	AFDB:A0A0D9RNP7	0.212	0.260	7.518E-13	819	0.131	0.168	A0A0D9RNP7.pdb.gz	A0A0D9RNP7_CHLSB PML nuclear body scaffold OS=Chlorocebus sabaeus OX=60711 GN=PML PE=4 SV=1
7	AFDB:B7YZK8	0.091	0.069	1.528E-4	1517	0.120	0.083	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
8	PDB:4tn3B	0.165	0.444	1.734E-4	362	0.037	0.108	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
9	AFDB:Q13459	0.082	0.046	6.657E-4	2157	0.108	0.052	Q13459.pdb.gz	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
10	AFDB:E7ESP9	0.095	0.111	5.719E-3	877	0.075	0.090	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
11	AFDB:O94964	0.069	0.052	1.415E-2	1423	0.089	0.065	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
12	AFDB:P0C1X8	0.038	0.041	1.877E-2	962	0.074	0.081	P0C1X8.pdb.gz	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
13	PDB:7y4sA	0.123	0.320	2.428E-1	343	0.023	0.070	7y4sA.pdb.gz
14	PDB:2lgvA	0.034	0.276	1.184	100	0.015	0.160	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
15	PDB:6tcaA	0.063	0.128	1.253	345	0.023	0.070	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
16	PDB:6j6qF	0.036	0.165	1.971	161	0.016	0.106	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:5gm6a	0.025	0.201	2.336	123	0.010	0.089	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7oniR	0.025	0.275	2.336	86	0.013	0.163	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:1x8zA	0.044	0.215	2.472	151	0.011	0.079	1x8zA.pdb.gz
20	PDB:4a0cF	0.027	0.317	2.616	80	0.010	0.138	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AI80	0.0	1826	1050	0.930	0.930	A0A8I6AI80_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1
2	A0A8I6APV0	0.0	762	850	0.429	0.529	A0A8I6APV0_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1
3	O15164	0.0	2174	1050	1.000	1.000	TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3
4	Q32PZ6	0.0	1026	607	0.535	0.926	Q32PZ6_RAT Trim24 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Trim24 PE=2 SV=1
5	Q64127	0.0	1833	1051	0.930	0.930	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
6	Q6E2N3	0.0	770	1163	0.460	0.415	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
7	Q7TP39	0.0	762	866	0.429	0.520	Q7TP39_RAT Ab2-427 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=1 SV=1
8	Q99PP7	0.0	908	1142	0.501	0.461	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
9	Q9UPN9	0.0	905	1127	0.502	0.468	TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3
10	Q62318	1.14e-79	280	834	0.134	0.169	TIF1B_MOUSE Transcription intermediary factor 1-beta OS=Mus musculus OX=10090 GN=Trim28 PE=1 SV=3
11	O08629	1.33e-79	280	835	0.134	0.169	TIF1B_RAT Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2
12	Q13263	1.62e-79	280	835	0.135	0.170	TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5
13	O15016	8.96e-65	242	1351	0.130	0.101	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
14	Q924W6	1.24e-62	235	1344	0.111	0.087	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
15	A0A0B4KHG7	1.61e-47	187	1122	0.121	0.113	A0A0B4KHG7_DROME Bonus, isoform F OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
16	A0A0B4KHT0	1.72e-47	187	1125	0.118	0.110	A0A0B4KHT0_DROME Bonus, isoform E OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
17	A8WHL4	1.77e-47	187	1125	0.118	0.110	A8WHL4_DROME Bonus, isoform B OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
18	A0A0B4KH12	1.84e-47	187	1119	0.118	0.111	A0A0B4KH12_DROME Bonus, isoform D OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
19	Q9VDK5	1.89e-47	187	1133	0.118	0.109	Q9VDK5_DROME Bonus, isoform A OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=2
20	Q9U3Y7	1.94e-47	187	1133	0.118	0.109	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	1.4e-17	74.9	Bromodomain
2	PF10534 CRIC_ras_sig	7.8e+02	11.6	Connector enhancer of kinase suppressor of ras
3	PF00628 PHD	3.7e-05	34.9	PHD-finger
4	PF00643 zf-B_box	1.8e-07	42.5	B-box zinc finger
5	PF00097 zf-C3HC4	13	17.0	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	34	15.7	Zinc finger, C3HC4 type (RING finger)
7	PF13639 zf-RING_2	7.4	18.3	Ring finger domain
8	PF14634 zf-RING_5	15	17.0	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	0.064	24.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.982	Estrogen receptor
2	9606.ENSP00000480826	0.965	Histone cluster 1 H3 family member a
3	9606.ENSP00000476960	0.955	Histone cluster 2 H3 pseudogene 2
4	9606.ENSP00000419692	0.948	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000366999	0.937	Histone cluster 1 H3 family member d
6	9606.ENSP00000484658	0.937	Histone cluster 1 H3 family member c
7	9606.ENSP00000352252	0.935	Histone cluster 1 H3 family member j
8	9606.ENSP00000358160	0.935	Histone cluster 1 H3 family member h
9	9606.ENSP00000483283	0.935	Histone cluster 1 H3 family member i
10	9606.ENSP00000484095	0.935	Histone cluster 1 H3 family member f
11	9606.ENSP00000484638	0.935	Histone cluster 1 H3 family member g
12	9606.ENSP00000484841	0.935	Histone H3.1
13	9606.ENSP00000371067	0.912	Tyrosine-protein kinase JAK2
14	9606.ENSP00000251849	0.909	RAF proto-oncogene serine/threonine-protein kinase
15	9606.ENSP00000209875	0.905	Chromobox protein homolog 5
16	9606.ENSP00000290277	0.904	Serine/threonine-protein kinase A-Raf
17	9606.ENSP00000319060	0.903	Calcium/calmodulin-dependent protein kinase type II subunit gamma
18	9606.ENSP00000339740	0.902	Calcium/calmodulin-dependent protein kinase type II subunit delta
19	9606.ENSP00000379098	0.902	Calcium/calmodulin-dependent protein kinase type II subunit beta
20	9606.ENSP00000381412	0.902	Calcium/calmodulin-dependent protein kinase type II subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0003713	0.999	transcription coactivator activity
GO:0002039	0.999	p53 binding
GO:0061630	0.999	ubiquitin protein ligase activity
GO:0043565	0.995	sequence-specific DNA binding
GO:0061629	0.885	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016773	0.866	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.865	kinase activity
GO:0004672	0.842	protein kinase activity
GO:0016922	0.806	nuclear receptor binding
GO:0019899	0.498	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0042221	0.957	response to chemical
GO:0043412	0.951	macromolecule modification
GO:0006807	0.937	nitrogen compound metabolic process
GO:0010033	0.912	response to organic substance
GO:0009719	0.892	response to endogenous stimulus
GO:0019222	0.879	regulation of metabolic process
GO:1901564	0.868	organonitrogen compound metabolic process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0080090	0.853	regulation of primary metabolic process
GO:0051171	0.849	regulation of nitrogen compound metabolic process
GO:0031323	0.848	regulation of cellular metabolic process
GO:0019538	0.830	protein metabolic process
GO:0010468	0.775	regulation of gene expression
GO:0048519	0.763	negative regulation of biological process
GO:0036211	0.755	protein modification process
GO:0019219	0.747	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.743	positive regulation of biological process
GO:0044237	0.734	cellular metabolic process
GO:0048523	0.697	negative regulation of cellular process
GO:0051252	0.693	regulation of RNA metabolic process
GO:0009889	0.685	regulation of biosynthetic process
GO:1903506	0.678	regulation of nucleic acid-templated transcription
GO:0048583	0.674	regulation of response to stimulus
GO:0048522	0.662	positive regulation of cellular process
GO:0006355	0.653	regulation of DNA-templated transcription
GO:0010646	0.593	regulation of cell communication
GO:0009966	0.565	regulation of signal transduction
GO:0051716	0.548	cellular response to stimulus
GO:0009893	0.468	positive regulation of metabolic process
GO:0010604	0.460	positive regulation of macromolecule metabolic process
GO:0009892	0.440	negative regulation of metabolic process
GO:0009725	0.436	response to hormone
GO:0010605	0.430	negative regulation of macromolecule metabolic process
GO:0031325	0.422	positive regulation of cellular metabolic process
GO:0051172	0.416	negative regulation of nitrogen compound metabolic process
GO:0051173	0.414	positive regulation of nitrogen compound metabolic process
GO:0045934	0.381	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.379	negative regulation of macromolecule biosynthetic process
GO:0031327	0.375	negative regulation of cellular biosynthetic process
GO:0051253	0.363	negative regulation of RNA metabolic process
GO:0032446	0.335	protein modification by small protein conjugation
GO:1902679	0.322	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.978	cytosol
GO:0043232	0.609	intracellular non-membrane-bounded organelle
GO:0005694	0.450	chromosome
GO:0000785	0.393	chromatin
GO:0000791	0.377	euchromatin
GO:0005726	0.373	perichromatin fibrils
GO:0001673	0.341	male germ cell nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.
EC:2.7.1.-	0.866	Phosphotransferases with an alcohol group as acceptor.

[back to server]