StarFunc result for job id O15165

User Input

>input (306 residues)
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSD
SAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISAS
TCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQNNAESTIVPIKGKDR
KPGNLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15165	1.000	1.000	3.527E-47	306	1.000	1.000	O15165.pdb.gz	LRAD4_HUMAN Low-density lipoprotein receptor class A domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LDLRAD4 PE=1 SV=1
2	AFDB:Q969W9	0.220	0.232	2.962E-21	287	0.569	0.606	Q969W9.pdb.gz	PMEPA_HUMAN Protein TMEPAI OS=Homo sapiens OX=9606 GN=PMEPA1 PE=1 SV=1
3	AFDB:G4LU05	0.122	0.064	4.283E-2	822	0.199	0.074	G4LU05.pdb.gz	G4LU05_DROME Neuropilin and tolloid-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=1
4	AFDB:A1Z9D7	0.122	0.035	7.214E-2	1678	0.176	0.032	A1Z9D7.pdb.gz	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
5	AFDB:Q9VYC7	0.155	0.082	9.362E-2	677	0.150	0.068	Q9VYC7.pdb.gz	Q9VYC7_DROME GH11189p OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=2
6	AFDB:Q5JRM2	0.116	0.100	3.026E-1	361	0.150	0.127	Q5JRM2.pdb.gz	CX066_HUMAN Uncharacterized protein CXorf66 OS=Homo sapiens OX=9606 GN=CXorf66 PE=1 SV=1
7	AFDB:Q7K3G5	0.089	0.059	4.774E-1	497	0.092	0.056	Q7K3G5.pdb.gz	Q7K3G5_DROME D4, isoform A OS=Drosophila melanogaster OX=7227 GN=d4 PE=1 SV=1
8	PDB:7nycC	0.111	0.044	7.993E-1	809	0.056	0.021	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
9	AFDB:B2RXR7	0.132	0.040	9.161E-1	1161	0.144	0.038	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
10	AFDB:P10275	0.096	0.042	1.446	920	0.141	0.047	P10275.pdb.gz	ANDR_HUMAN Androgen receptor OS=Homo sapiens OX=9606 GN=AR PE=1 SV=3
11	AFDB:Q9JLL3	0.110	0.088	1.446	416	0.170	0.125	Q9JLL3.pdb.gz	TNR19_MOUSE Tumor necrosis factor receptor superfamily member 19 OS=Mus musculus OX=10090 GN=Tnfrsf19 PE=1 SV=2
12	PDB:4a5wB	0.096	0.037	2.420	871	0.069	0.024	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15165	0.0	635	306	1.000	1.000	LRAD4_HUMAN Low-density lipoprotein receptor class A domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LDLRAD4 PE=1 SV=1
2	Q8BWJ4	0.0	548	306	0.902	0.902	LRAD4_MOUSE Low-density lipoprotein receptor class A domain-containing protein 4 OS=Mus musculus OX=10090 GN=Ldlrad4 PE=2 SV=1
3	Q969W9	2.00e-99	295	287	0.549	0.585	PMEPA_HUMAN Protein TMEPAI OS=Homo sapiens OX=9606 GN=PMEPA1 PE=1 SV=1
4	Q9D7R2	2.80e-97	289	260	0.533	0.627	PMEPA_MOUSE Protein TMEPAI OS=Mus musculus OX=10090 GN=Pmepa1 PE=1 SV=1
5	A2A2F5	6.71e-50	167	227	0.314	0.423	A2A2F5_HUMAN Prostate transmembrane protein, androgen induced 1 (Fragment) OS=Homo sapiens OX=9606 GN=PMEPA1 PE=3 SV=1
6	Q8BUJ9	7.04e-05	46.6	858	0.092	0.033	LRP12_MOUSE Low-density lipoprotein receptor-related protein 12 OS=Mus musculus OX=10090 GN=Lrp12 PE=2 SV=2
7	Q9Y561	8.79e-05	46.6	859	0.092	0.033	LRP12_HUMAN Low-density lipoprotein receptor-related protein 12 OS=Homo sapiens OX=9606 GN=LRP12 PE=1 SV=1
8	A2ARV4	5.72e-04	43.9	4660	0.069	0.005	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
9	Q9QXT7	6.38e-04	43.5	769	0.065	0.026	Q9QXT7_MOUSE Complement component 6 OS=Mus musculus OX=10090 GN=C6 PE=2 SV=1
10	Q91X70	6.49e-04	43.5	769	0.065	0.026	Q91X70_MOUSE Complement component 6 OS=Mus musculus OX=10090 GN=C6 PE=1 SV=1
11	Q811M5	6.63e-04	43.5	934	0.072	0.024	CO6_RAT Complement component C6 OS=Rattus norvegicus OX=10116 GN=C6 PE=2 SV=1
12	Q8CG65	7.87e-04	43.5	4998	0.069	0.004	SSPO_MOUSE SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2
13	E9Q6D8	0.001	43.1	934	0.065	0.021	E9Q6D8_MOUSE Complement component C6 OS=Mus musculus OX=10090 GN=C6 PE=1 SV=2
14	Q7Z4F1	0.001	42.7	713	0.075	0.032	LRP10_HUMAN Low-density lipoprotein receptor-related protein 10 OS=Homo sapiens OX=9606 GN=LRP10 PE=1 SV=2
15	Q8BRY4	0.001	42.4	261	0.065	0.077	Q8BRY4_MOUSE Complement component 6 (Fragment) OS=Mus musculus OX=10090 GN=C6 PE=1 SV=1
16	F1QY34	0.002	42.4	4549	0.069	0.005	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
17	P13671	0.002	42.0	934	0.062	0.020	CO6_HUMAN Complement component C6 OS=Homo sapiens OX=9606 GN=C6 PE=1 SV=3
18	P98158	0.002	42.7	4660	0.065	0.004	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
19	Q8VI56	0.002	42.0	1905	0.065	0.010	LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus OX=10090 GN=Lrp4 PE=1 SV=3
20	Q90W12	0.002	42.4	847	0.059	0.021	Q90W12_ONCMY Vitellogenin receptor OS=Oncorhynchus mykiss OX=8022 GN=vtg receptor PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11027 DUF2615	53	15.4	Protein of unknown function (DUF2615)
2	PF00057 Ldl_recept_a	0.00023	32.6	Low-density lipoprotein receptor domain class A
3	PF12216 m04gp34like	2.7e+02	12.5	Immune evasion protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352420

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000397435	0.756	TSC22 domain family protein 1
2	9606.ENSP00000323635	0.734	Protein FAM210A
3	9606.ENSP00000262160	0.730	Mothers against decapentaplegic homolog 2
4	9606.ENSP00000239367	0.617	Low-density lipoprotein receptor-related protein 11
5	9606.ENSP00000360069	0.603	Zinc finger protein 831
6	9606.ENSP00000477781	0.590	Translationally-controlled tumor protein
7	9606.ENSP00000479860	0.587	Calcium and integrin binding 1
8	9606.ENSP00000424827	0.565	E3 ubiquitin-protein ligase NEDD4
9	9606.ENSP00000332973	0.557	Mothers against decapentaplegic homolog 3
10	9606.ENSP00000454071	0.538	Low-density lipoprotein receptor
11	9606.ENSP00000234071	0.522	Vitamin K-dependent protein C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070412	1.000	R-SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048523	0.985	negative regulation of cellular process
GO:0009966	0.979	regulation of signal transduction
GO:0030512	0.967	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0080090	0.897	regulation of primary metabolic process
GO:0051171	0.891	regulation of nitrogen compound metabolic process
GO:0031324	0.890	negative regulation of cellular metabolic process
GO:0010605	0.888	negative regulation of macromolecule metabolic process
GO:0051172	0.815	negative regulation of nitrogen compound metabolic process
GO:0051246	0.362	regulation of protein metabolic process
GO:0051128	0.342	regulation of cellular component organization
GO:0051239	0.318	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0031982	0.997	vesicle
GO:0031090	0.997	organelle membrane
GO:0031410	0.981	cytoplasmic vesicle
GO:0098588	0.973	bounding membrane of organelle
GO:0030659	0.967	cytoplasmic vesicle membrane
GO:0005768	0.961	endosome
GO:0031901	0.936	early endosome membrane
GO:0071944	0.804	cell periphery
GO:0005886	0.783	plasma membrane
GO:0005829	0.411	cytosol
GO:0005634	0.369	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]