StarFunc result for job id O15169

User Input

>input (862 residues)
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGV
ACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR
ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPC
DSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDEAVLPVFEEKIIGKVEKVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15169	1.000	1.000	0.000	862	1.000	1.000	O15169.pdb.gz	AXIN1_HUMAN Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2
2	AFDB:O35625	0.277	0.277	0.000	863	0.874	0.873	O35625.pdb.gz	AXIN1_MOUSE Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3
3	AFDB:A0A0S2Z4M1	0.197	0.216	3.945E-103	779	0.900	0.996	A0A0S2Z4M1.pdb.gz	A0A0S2Z4M1_HUMAN Axin 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=1
4	AFDB:Q14DJ8	0.212	0.216	3.833E-99	832	0.835	0.865	Q14DJ8.pdb.gz	Q14DJ8_MOUSE Axin 1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=1
5	AFDB:Q9YGY0	0.275	0.280	3.515E-87	842	0.662	0.678	Q9YGY0.pdb.gz	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
6	AFDB:P57094	0.297	0.305	7.712E-82	835	0.632	0.653	P57094.pdb.gz	AXIN1_DANRE Axin-1 OS=Danio rerio OX=7955 GN=axin1 PE=1 SV=2
7	PDB:1agrE	0.137	0.857	2.812E-7	128	0.043	0.289	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
8	PDB:3pvuA	0.134	0.186	3.104E-5	609	0.039	0.056	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
9	PDB:4mk0A	0.134	0.178	3.104E-5	631	0.038	0.052	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	AFDB:Q9Y6J0	0.062	0.031	1.006E-4	2220	0.146	0.057	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
11	AFDB:A0A0R4IR86	0.061	0.037	2.954E-4	1799	0.119	0.057	A0A0R4IR86.pdb.gz	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
12	PDB:7shfC	0.135	0.282	6.258E-4	400	0.035	0.075	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
13	PDB:3uzsA	0.129	0.180	7.418E-4	609	0.038	0.054	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
14	AFDB:Q75J96	0.068	0.058	1.444E-3	1055	0.099	0.081	Q75J96.pdb.gz	RGAP1_DICDI RapA guanosine triphosphatase-activating protein 1 OS=Dictyostelium discoideum OX=44689 GN=rapgap1 PE=2 SV=1
15	AFDB:Q6P3W6	0.057	0.058	1.917E-3	841	0.113	0.115	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
16	PDB:4yhjA	0.131	0.220	3.627E-3	501	0.021	0.036	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
17	PDB:6pjxA	0.127	0.198	1.006E-2	543	0.027	0.042	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
18	PDB:2hdeA	0.080	0.352	1.151E-1	148	0.020	0.115	2hdeA.pdb.gz
19	PDB:4gouA	0.120	0.199	1.289E-1	507	0.028	0.047	4gouA.pdb.gz
20	PDB:4a9aA	0.076	0.172	1.617E-1	356	0.012	0.028	4a9aA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4M1	0.0	1565	779	0.904	1.000	A0A0S2Z4M1_HUMAN Axin 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=1
2	O15169	0.0	1776	862	1.000	1.000	AXIN1_HUMAN Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2
3	O35625	0.0	1460	863	0.875	0.874	AXIN1_MOUSE Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3
4	O70239	0.0	1385	827	0.842	0.878	AXIN1_RAT Axin-1 OS=Rattus norvegicus OX=10116 GN=Axin1 PE=1 SV=3
5	O70240	0.0	564	838	0.437	0.450	AXIN2_RAT Axin-2 OS=Rattus norvegicus OX=10116 GN=Axin2 PE=1 SV=1
6	O88566	0.0	567	840	0.439	0.450	AXIN2_MOUSE Axin-2 OS=Mus musculus OX=10090 GN=Axin2 PE=1 SV=2
7	P57094	0.0	1023	835	0.638	0.659	AXIN1_DANRE Axin-1 OS=Danio rerio OX=7955 GN=axin1 PE=1 SV=2
8	Q14DJ8	0.0	1377	832	0.839	0.869	Q14DJ8_MOUSE Axin 1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=1
9	Q9Y2T1	0.0	578	843	0.440	0.450	AXIN2_HUMAN Axin-2 OS=Homo sapiens OX=9606 GN=AXIN2 PE=1 SV=2
10	Q9YGY0	0.0	1119	842	0.669	0.685	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
11	P57095	3.10e-169	513	812	0.429	0.456	AXIN2_DANRE Axin-2 OS=Danio rerio OX=7955 GN=axin2 PE=1 SV=1
12	Q9PTP2	3.32e-127	400	706	0.350	0.428	AXNR_XENLA Axin-related protein OS=Xenopus laevis OX=8355 PE=1 SV=1
13	Q9V407	6.88e-17	87.8	745	0.066	0.077	AXN_DROME Axin OS=Drosophila melanogaster OX=7227 GN=Axn PE=1 SV=1
14	V9GXQ3	1.62e-16	79.7	152	0.058	0.329	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
15	A0A5S9EHU3	2.52e-16	79.0	147	0.058	0.340	A0A5S9EHU3_MOUSE Regulator of G protein Signaling 21 variant 2 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
16	A0A087WUY2	4.88e-16	79.3	192	0.064	0.286	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
17	P49797	1.02e-15	84.3	967	0.064	0.057	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
18	P49796	1.15e-15	84.3	1198	0.055	0.039	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
19	P49806	1.94e-15	77.4	181	0.053	0.254	RGS10_RAT Regulator of G-protein signaling 10 OS=Rattus norvegicus OX=10116 GN=Rgs10 PE=1 SV=2
20	Q2M5E4	2.18e-15	76.3	152	0.052	0.296	RGS21_HUMAN Regulator of G-protein signaling 21 OS=Homo sapiens OX=9606 GN=RGS21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16646 AXIN1_TNKS_BD	4.2e-22	89.9	Axin-1 tankyrase binding domain
2	PF08833 Axin_b-cat_bind	4.5e-10	50.5	Axin beta-catenin binding motif
3	PF00778 DIX	6.1e-25	98.2	DIX domain
4	PF00615 RGS	1.3e-22	91.7	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005340	0.999	Segment polarity protein dishevelled homolog DVL-2
2	9606.ENSP00000222330	0.999	Glycogen synthase kinase-3 alpha
3	9606.ENSP00000257430	0.999	Adenomatous polyposis coli protein
4	9606.ENSP00000261349	0.999	Low-density lipoprotein receptor-related protein 6
5	9606.ENSP00000294304	0.999	Low-density lipoprotein receptor-related protein 5
6	9606.ENSP00000324806	0.999	Glycogen synthase kinase-3 beta
7	9606.ENSP00000329117	0.999	APC membrane recruitment protein 1
8	9606.ENSP00000344456	0.999	Catenin beta-1
9	9606.ENSP00000359206	0.999	F-box/WD repeat-containing protein 1A
10	9606.ENSP00000368169	0.999	Segment polarity protein dishevelled homolog DVL-1
11	9606.ENSP00000421689	0.999	Casein kinase I isoform alpha
12	9606.ENSP00000262158	0.998	Mothers against decapentaplegic homolog 7
13	9606.ENSP00000311579	0.998	Tankyrase-1
14	9606.ENSP00000380044	0.998	Casein kinase I isoform epsilon
15	9606.ENSP00000349156	0.996	E3 ubiquitin-protein ligase SIAH1
16	9606.ENSP00000360060	0.996	Proto-oncogene FRAT1
17	9606.ENSP00000382423	0.996	Mitogen-activated protein kinase kinase kinase 1
18	9606.ENSP00000332973	0.995	Mothers against decapentaplegic homolog 3
19	9606.ENSP00000269141	0.993	Cadherin-2
20	9606.ENSP00000324856	0.992	Serine/threonine-protein kinase STK11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.991	enzyme binding
GO:0008013	0.967	beta-catenin binding
GO:0042802	0.964	identical protein binding
GO:0031625	0.953	ubiquitin protein ligase binding
GO:0060090	0.921	molecular adaptor activity
GO:0046332	0.896	SMAD binding
GO:0035591	0.657	signaling adaptor activity
GO:0030159	0.647	signaling receptor complex adaptor activity
GO:0070411	0.516	I-SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0009987	0.988	cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0030111	0.987	regulation of Wnt signaling pathway
GO:0048519	0.985	negative regulation of biological process
GO:0048523	0.983	negative regulation of cellular process
GO:0048522	0.975	positive regulation of cellular process
GO:0009968	0.969	negative regulation of signal transduction
GO:0050896	0.968	response to stimulus
GO:0090090	0.960	negative regulation of canonical Wnt signaling pathway
GO:0010604	0.952	positive regulation of macromolecule metabolic process
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0042325	0.934	regulation of phosphorylation
GO:0031401	0.932	positive regulation of protein modification process
GO:0044093	0.928	positive regulation of molecular function
GO:0045937	0.927	positive regulation of phosphate metabolic process
GO:0050790	0.924	regulation of catalytic activity
GO:0001932	0.915	regulation of protein phosphorylation
GO:0042327	0.909	positive regulation of phosphorylation
GO:0001934	0.904	positive regulation of protein phosphorylation
GO:0043085	0.903	positive regulation of catalytic activity
GO:0051338	0.895	regulation of transferase activity
GO:0045859	0.887	regulation of protein kinase activity
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0051347	0.855	positive regulation of transferase activity
GO:0009894	0.853	regulation of catabolic process
GO:0010468	0.850	regulation of gene expression
GO:0010556	0.848	regulation of macromolecule biosynthetic process
GO:0031326	0.848	regulation of cellular biosynthetic process
GO:0051252	0.848	regulation of RNA metabolic process
GO:0045860	0.830	positive regulation of protein kinase activity
GO:2001141	0.815	regulation of RNA biosynthetic process
GO:0006355	0.813	regulation of DNA-templated transcription
GO:0045935	0.783	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.708	cellular response to stimulus
GO:0009891	0.708	positive regulation of biosynthetic process
GO:0045893	0.700	positive regulation of DNA-templated transcription
GO:0071840	0.689	cellular component organization or biogenesis
GO:0009896	0.667	positive regulation of catabolic process
GO:0045862	0.664	positive regulation of proteolysis
GO:0016043	0.658	cellular component organization
GO:0031329	0.581	regulation of cellular catabolic process
GO:0007165	0.569	signal transduction
GO:0050793	0.545	regulation of developmental process
GO:0032502	0.533	developmental process
GO:0071704	0.526	organic substance metabolic process
GO:0048856	0.524	anatomical structure development
GO:0032501	0.495	multicellular organismal process
GO:0009892	0.449	negative regulation of metabolic process
GO:0006807	0.447	nitrogen compound metabolic process
GO:0044238	0.443	primary metabolic process
GO:0042176	0.440	regulation of protein catabolic process
GO:0048584	0.432	positive regulation of response to stimulus
GO:0043170	0.411	macromolecule metabolic process
GO:0010605	0.407	negative regulation of macromolecule metabolic process
GO:0031331	0.403	positive regulation of cellular catabolic process
GO:1903320	0.365	regulation of protein modification by small protein conjugation or removal
GO:0031398	0.358	positive regulation of protein ubiquitination
GO:0051172	0.347	negative regulation of nitrogen compound metabolic process
GO:0007275	0.346	multicellular organism development
GO:0044237	0.344	cellular metabolic process
GO:0007166	0.327	cell surface receptor signaling pathway
GO:0009967	0.323	positive regulation of signal transduction
GO:1902531	0.301	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:1902494	0.996	catalytic complex
GO:0005886	0.993	plasma membrane
GO:0005829	0.992	cytosol
GO:0005634	0.982	nucleus
GO:0030877	0.978	beta-catenin destruction complex
GO:0070013	0.921	intracellular organelle lumen
GO:0043228	0.897	non-membrane-bounded organelle
GO:0031982	0.872	vesicle
GO:0043232	0.846	intracellular non-membrane-bounded organelle
GO:0012505	0.635	endomembrane system
GO:0031410	0.402	cytoplasmic vesicle
GO:0031981	0.371	nuclear lumen
GO:0005654	0.336	nucleoplasm
GO:0016328	0.301	lateral plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]