StarFunc result for job id O15178

User Input

>input (435 residues)
MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPG
YSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS
PTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTP
GSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQ
GRLIASWTPVSPPSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A4W8	0.544	0.543	2.881E-65	436	0.920	0.917	D4A4W8.pdb.gz	D4A4W8_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=2
2	AFDB:F1NZI2	0.541	0.543	2.591E-59	433	0.807	0.811	F1NZI2.pdb.gz
3	AFDB:P24781	0.529	0.533	2.457E-56	432	0.733	0.738	P24781.pdb.gz	TBXT_XENLA T-box transcription factor T OS=Xenopus laevis OX=8355 GN=tbxt PE=1 SV=1
4	AFDB:Q07998	0.514	0.527	3.949E-48	423	0.598	0.615	Q07998.pdb.gz	TBXTA_DANRE T-box transcription factor T-A OS=Danio rerio OX=7955 GN=tbxta PE=1 SV=1
5	AFDB:O60806	0.535	0.520	2.376E-44	448	0.556	0.540	O60806.pdb.gz	TBX19_HUMAN T-box transcription factor TBX19 OS=Homo sapiens OX=9606 GN=TBX19 PE=1 SV=3
6	AFDB:P55965	0.425	0.270	1.449E-34	697	0.428	0.267	P55965.pdb.gz	BYN_DROME T-related protein OS=Drosophila melanogaster OX=7227 GN=byn PE=2 SV=2
7	AFDB:P70325	0.418	0.333	2.872E-30	552	0.340	0.268	P70325.pdb.gz	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
8	AFDB:Q9IAK8	0.414	0.367	1.353E-29	492	0.343	0.303	Q9IAK8.pdb.gz	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
9	AFDB:G1K2W9	0.428	0.433	1.823E-29	430	0.301	0.305	G1K2W9.pdb.gz
10	AFDB:O93288	0.421	0.340	2.313E-29	541	0.343	0.275	O93288.pdb.gz	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
11	PDB:1yycA	0.173	0.364	4.589E-3	174	0.055	0.138	1yycA.pdb.gz
12	PDB:7tysA	0.161	0.184	2.912E-2	361	0.055	0.066	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
13	PDB:2r51A	0.152	0.207	3.091E-2	288	0.046	0.069	2r51A.pdb.gz
14	PDB:7q1yA	0.141	0.059	4.164E-2	1374	0.039	0.012	7q1yA.pdb.gz
15	PDB:1d6vL	0.112	0.186	4.691E-2	211	0.037	0.076	1d6vL.pdb.gz	Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
16	PDB:4ziqA	0.141	0.054	5.609E-2	1450	0.025	0.008	4ziqA.pdb.gz
17	PDB:2ag2A	0.130	0.232	5.954E-2	164	0.069	0.183	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
18	PDB:3s3sA	0.146	0.109	6.708E-2	620	0.044	0.031	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
19	PDB:4akrC	0.079	0.115	9.592E-2	271	0.044	0.070	4akrC.pdb.gz
20	PDB:3fxiC	0.111	0.249	1.081E-1	140	0.030	0.093	3fxiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AEA5	0.0	699	396	0.816	0.896	A0A8I6AEA5_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=1
2	D4A4W8	0.0	808	437	0.913	0.908	D4A4W8_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=2
3	J3KP65	0.0	891	436	0.998	0.995	J3KP65_HUMAN T-box transcription factor T OS=Homo sapiens OX=9606 GN=TBXT PE=1 SV=9
4	O15178	0.0	900	435	1.000	1.000	TBXT_HUMAN T-box transcription factor T OS=Homo sapiens OX=9606 GN=TBXT PE=1 SV=1
5	P20293	0.0	812	436	0.910	0.908	TBXT_MOUSE T-box transcription factor T OS=Mus musculus OX=10090 GN=Tbxt PE=1 SV=1
6	P24781	0.0	668	432	0.743	0.748	TBXT_XENLA T-box transcription factor T OS=Xenopus laevis OX=8355 GN=tbxt PE=1 SV=1
7	P79777	0.0	714	433	0.802	0.806	TBXT_CHICK T-box transcription factor T OS=Gallus gallus OX=9031 GN=TBXT PE=2 SV=1
8	Q07998	0.0	528	423	0.614	0.631	TBXTA_DANRE T-box transcription factor T-A OS=Danio rerio OX=7955 GN=tbxta PE=1 SV=1
9	Q99ME7	1.63e-160	462	446	0.559	0.545	TBX19_MOUSE T-box transcription factor TBX19 OS=Mus musculus OX=10090 GN=Tbx19 PE=2 SV=1
10	O60806	3.06e-156	451	448	0.547	0.531	TBX19_HUMAN T-box transcription factor TBX19 OS=Homo sapiens OX=9606 GN=TBX19 PE=1 SV=3
11	P55965	7.62e-102	320	697	0.338	0.211	BYN_DROME T-related protein OS=Drosophila melanogaster OX=7227 GN=byn PE=2 SV=2
12	Q9PWE8	4.36e-63	214	521	0.230	0.192	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
13	Q9IAK8	5.03e-63	213	492	0.230	0.203	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
14	Q99593	6.69e-63	213	518	0.230	0.193	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
15	P70326	8.08e-63	213	518	0.230	0.193	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
16	Q5I2P1	4.11e-62	211	517	0.228	0.191	TBX5_RAT T-box transcription factor TBX5 OS=Rattus norvegicus OX=10116 GN=Tbx5 PE=2 SV=1
17	P70325	5.25e-62	212	552	0.225	0.178	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
18	P57082	7.59e-62	211	545	0.225	0.180	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
19	E3W6T6	1.82e-61	207	422	0.221	0.227	E3W6T6_DANRE T-box 5b isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-114c15.2 PE=2 SV=1
20	Q19691	4.25e-61	206	423	0.244	0.251	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	4.1e-66	233.9	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442439	0.813	Homeobox protein MIXL1
2	9606.ENSP00000355001	0.785	POU domain, class 3, transcription factor 3
3	9606.ENSP00000457810	0.764	Centromere protein T
4	9606.ENSP00000297316	0.738	Transcription factor SOX-17
5	9606.ENSP00000229307	0.734	Homeobox protein NANOG
6	9606.ENSP00000426653	0.711	Protein Wnt-8a
7	9606.ENSP00000400341	0.705	Hepatocyte nuclear factor 3-beta
8	9606.ENSP00000238558	0.701	Homeobox protein goosecoid
9	9606.ENSP00000284523	0.700	Protein Wnt-3a
10	9606.ENSP00000323588	0.692	Transcription factor SOX-2
11	9606.ENSP00000334458	0.692	Transcription factor GATA-4
12	9606.ENSP00000245451	0.688	Bone morphogenetic protein 4
13	9606.ENSP00000395654	0.677	Transcription activator BRG1
14	9606.ENSP00000343819	0.676	Homeobox protein OTX2
15	9606.ENSP00000259915	0.674	POU domain, class 5, transcription factor 1
16	9606.ENSP00000204604	0.673	Chordin
17	9606.ENSP00000426568	0.666	Mothers against decapentaplegic homolog 1
18	9606.ENSP00000250003	0.662	Myoblast determination protein 1
19	9606.ENSP00000263923	0.657	Vascular endothelial growth factor receptor 2
20	9606.ENSP00000327758	0.649	Homeobox protein Nkx-2.5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.971	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.788	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.769	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.997	multicellular organism development
GO:0009987	0.994	cellular process
GO:0048731	0.989	system development
GO:0048513	0.988	animal organ development
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0031325	0.985	positive regulation of cellular metabolic process
GO:0030154	0.981	cell differentiation
GO:0051173	0.981	positive regulation of nitrogen compound metabolic process
GO:0010604	0.971	positive regulation of macromolecule metabolic process
GO:0009891	0.965	positive regulation of biosynthetic process
GO:0045935	0.965	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.964	positive regulation of cellular biosynthetic process
GO:0051254	0.964	positive regulation of RNA metabolic process
GO:1902680	0.949	positive regulation of RNA biosynthetic process
GO:0072359	0.931	circulatory system development
GO:0006357	0.918	regulation of transcription by RNA polymerase II
GO:0045893	0.917	positive regulation of DNA-templated transcription
GO:0007507	0.903	heart development
GO:0035051	0.851	cardiocyte differentiation
GO:0009888	0.845	tissue development
GO:0009653	0.840	anatomical structure morphogenesis
GO:0050896	0.805	response to stimulus
GO:0009790	0.778	embryo development
GO:0035282	0.758	segmentation
GO:0045944	0.714	positive regulation of transcription by RNA polymerase II
GO:0061061	0.518	muscle structure development
GO:0051716	0.502	cellular response to stimulus
GO:0009798	0.433	axis specification
GO:0048519	0.368	negative regulation of biological process
GO:0048523	0.338	negative regulation of cellular process
GO:0050793	0.327	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005694	0.839	chromosome
GO:0000785	0.795	chromatin
GO:0005737	0.578	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]