StarFunc result for job id O15195

User Input

>input (856 residues)
MDISKGLPGMQGGLHIWISENRKMVPVPEGAYGNFFEEHCYVILHVPQSPKATQGASSDL
HYWVGKQAGAEAQGAAEAFQQRLQDELGGQTVLHREAQGHESDCFCSYFRPGIIYRKGGL
ASDLKHVETNLFNIQRLLHIKGRKHVSATEVELSWNSFNKGDIFLLDLGKMMIQWNGPKT
SISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEAVLGRRVGSLRAATPS
KDINQLQKANVRLYHVYEKGKDLVVLELATPPLTQDLLQEEDFYILDQGGFKIYVWQGRM
SSLQERKAAFSRAVGFIQAKGYPTYTNVEVVNDGAESAAFKQLFRTWSEKRRRNQKLGGR
DKSIHVKLDVGKLHTQPKLAAQLRMVDDGSGKVEVWCIQDLHRQPVDPKRHGQLCAGNCY
LVLYTYQRLGRVQYILYLWQGHQATADEIEALNSNAEELDVMYGGVLVQEHVTMGSEPPH
FLAIFQGQLVIFQERAGHHGKGQSASTTRLFQVQGTDSHNTRTMEVPARASSLNSSDIFL
LVTASVCYLWFGKGCNGDQREMARVVVTVISRKNEETVLEGQEPPHFWEALGGRAPYPSN
KRLPEEVPSFQPRLFECSSHMGCLVLAEVGFFSQEDLDKYDIMLLDTWQEIFLWLGEAAS
EWKEAVAWGQEYLKTHPAGRSPATPIVLVKQGHEPPTFIGWFFTWDPYKWTSHPSHKEVV
DGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSR
TSSSVSSTSATINGGLRREQLMHQAVEDLPEGVDPARREFYLSDSDFQDIFGKSKEEFYS
MATWRQRQEKKQLGFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15195	1.000	1.000	0.000	856	1.000	1.000	O15195.pdb.gz	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
2	AFDB:O75366	0.772	0.805	0.000	819	0.444	0.464	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
3	AFDB:P09327	0.517	0.534	9.305E-103	827	0.461	0.478	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
4	AFDB:O88398	0.504	0.525	7.231E-95	819	0.445	0.465	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
5	AFDB:P06396	0.682	0.741	4.366E-79	782	0.339	0.371	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
6	PDB:6jegB	0.661	0.776	1.623E-77	718	0.338	0.403	6jegB.pdb.gz
7	AFDB:Q10L71	0.578	0.522	2.883E-71	966	0.314	0.278	Q10L71.pdb.gz	VLN2_ORYSJ Villin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN2 PE=2 SV=1
8	AFDB:O81644	0.580	0.519	3.992E-71	976	0.300	0.263	O81644.pdb.gz	VILI2_ARATH Villin-2 OS=Arabidopsis thaliana OX=3702 GN=VLN2 PE=1 SV=2
9	AFDB:Q5ZIV9	0.250	0.296	8.080E-71	717	0.331	0.395	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
10	AFDB:F4ILN8	0.604	0.560	6.345E-70	933	0.272	0.250	F4ILN8.pdb.gz	F4ILN8_ARATH Villin-like 1 OS=Arabidopsis thaliana OX=3702 GN=VLN1 PE=1 SV=1
11	AFDB:E9PU64	0.248	0.295	8.785E-70	715	0.334	0.400	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
12	PDB:1j72A	0.122	0.300	2.140E-29	337	0.158	0.401	1j72A.pdb.gz
13	PDB:7cccB	0.084	0.179	2.814E-5	342	0.053	0.132	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:2mv2A	0.076	0.352	1.097E-2	148	0.018	0.101	2mv2A.pdb.gz
15	PDB:2i2qA	0.084	0.449	1.158E-2	122	0.021	0.148	2i2qA.pdb.gz
16	PDB:1cofA	0.083	0.413	1.603E-2	135	0.020	0.126	1cofA.pdb.gz
17	PDB:1m2vA	0.085	0.101	1.693E-2	705	0.028	0.034	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
18	PDB:1udmA	0.096	0.452	1.787E-2	149	0.019	0.107	1udmA.pdb.gz
19	PDB:2zxcA	0.079	0.095	2.220E-2	643	0.071	0.095	2zxcA.pdb.gz	Mechanistic insights into the hydrolysis and synthesis of ceramide by neutral ceramidase.
20	PDB:4s2rP	0.067	0.083	2.912E-2	615	0.041	0.057	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15195	0.0	1781	856	1.000	1.000	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
2	O75366	0.0	772	819	0.451	0.471	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
3	O88398	0.0	746	819	0.453	0.474	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
4	P09327	0.0	805	827	0.477	0.493	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
5	Q62468	0.0	783	827	0.470	0.486	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
6	Q9WU06	0.0	749	819	0.457	0.477	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
7	G1U9R8	2.69e-174	523	739	0.342	0.396	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
8	Q28046	4.99e-174	522	715	0.338	0.404	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
9	E9PU64	1.02e-173	521	715	0.338	0.404	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
10	Q60604	3.61e-173	520	715	0.338	0.404	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
11	Q7TQ08	1.00e-172	518	715	0.335	0.401	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
12	Q5ZIV9	3.26e-170	512	717	0.326	0.389	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
13	P20305	4.49e-170	513	772	0.336	0.373	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
14	P06396	1.87e-169	512	782	0.339	0.371	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
15	P13020	3.21e-169	511	780	0.334	0.367	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
16	Q9Y6U3	3.02e-168	507	715	0.327	0.392	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
17	Q68FP1	1.65e-167	507	780	0.328	0.360	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
18	B4DV78	1.26e-164	490	516	0.298	0.494	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1
19	A0JMJ1	1.87e-162	492	720	0.328	0.390	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
20	O81645	1.44e-95	323	965	0.270	0.239	VILI3_ARATH Villin-3 OS=Arabidopsis thaliana OX=3702 GN=VLN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19894 DUF6367	3.5e+02	12.3	Family of unknown function (DUF6367)
2	PF00626 Gelsolin	4.3e-69	239.7	Gelsolin repeat
3	PF02209 VHP	1.1e-09	49.3	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000413537	0.690	AP20 region protein 1
2	9606.ENSP00000485610	0.690	Chromosome 3 open reading frame 35
3	9606.ENSP00000396467	0.622	MAP kinase-activated protein kinase 3
4	9606.ENSP00000273179	0.613	CTD small phosphatase-like protein
5	9606.ENSP00000232501	0.604	GATOR complex protein NPRL2
6	9606.ENSP00000302728	0.585	Beta-glucuronidase
7	9606.ENSP00000348128	0.577	Supervillin
8	9606.ENSP00000248444	0.536	Villin-1
9	9606.ENSP00000290607	0.509	StAR-related lipid transfer protein 9
10	9606.ENSP00000273173	0.502	Solute carrier family 22 member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005200	0.996	structural constituent of cytoskeleton
GO:0003779	0.991	actin binding
GO:0044877	0.901	protein-containing complex binding
GO:0051015	0.894	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0071840	0.907	cellular component organization or biogenesis
GO:0016043	0.902	cellular component organization
GO:0007010	0.861	cytoskeleton organization
GO:0051128	0.735	regulation of cellular component organization
GO:0030029	0.733	actin filament-based process
GO:0050896	0.512	response to stimulus
GO:0048519	0.505	negative regulation of biological process
GO:0048523	0.498	negative regulation of cellular process
GO:0048518	0.379	positive regulation of biological process
GO:0033043	0.351	regulation of organelle organization
GO:0030036	0.341	actin cytoskeleton organization
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	0.996	actin cytoskeleton
GO:0005737	0.858	cytoplasm
GO:0043227	0.810	membrane-bounded organelle
GO:0043231	0.760	intracellular membrane-bounded organelle
GO:0005829	0.606	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]