StarFunc result for job id O15197

User Input

>input (1021 residues)
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWA
VGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFA
SFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCR
CQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSD
PPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAIN
VSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTS
ETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSI
LGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRE
LAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRA
AVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVA
AAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQK
DRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAI
GLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVE
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JY48	0.431	0.445	0.000	986	0.466	0.483	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
2	AFDB:A0A3B3IRY8	0.411	0.398	0.000	1055	0.456	0.442	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
3	AFDB:F1RCL1	0.382	0.397	0.000	976	0.393	0.411	F1RCL1.pdb.gz
4	AFDB:O08680	0.329	0.340	0.000	984	0.384	0.398	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
5	AFDB:O15197	1.000	1.000	0.000	1021	1.000	1.000	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
6	AFDB:O73875	0.422	0.434	0.000	987	0.415	0.430	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
7	AFDB:O73878	0.432	0.449	0.000	976	0.413	0.432	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
8	AFDB:P29323	0.419	0.407	0.000	1055	0.451	0.436	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
9	AFDB:P54753	0.453	0.461	0.000	998	0.452	0.462	P54753.pdb.gz	EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens OX=9606 GN=EPHB3 PE=1 SV=2
10	AFDB:P54756	0.534	0.527	0.000	1037	0.400	0.393	P54756.pdb.gz	EPHA5_HUMAN Ephrin type-A receptor 5 OS=Homo sapiens OX=9606 GN=EPHA5 PE=1 SV=3
11	PDB:1k9aB	0.235	0.529	3.100E-19	441	0.086	0.200	1k9aB.pdb.gz
12	PDB:4fl2A	0.239	0.429	3.256E-19	555	0.085	0.157	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.238	0.431	3.592E-19	551	0.090	0.167	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:2h8hA	0.228	0.499	1.816E-18	445	0.107	0.245	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:6lk5A	0.228	0.810	7.749E-13	265	0.051	0.196	6lk5A.pdb.gz
16	PDB:6uanB	0.207	0.748	1.093E-12	261	0.072	0.284	6uanB.pdb.gz
17	PDB:6s73A	0.223	0.778	1.397E-12	269	0.054	0.204	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:8dksA	0.205	0.677	1.541E-12	283	0.051	0.184	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
19	PDB:4btfA	0.219	0.514	1.619E-12	413	0.053	0.131	4btfA.pdb.gz
20	PDB:4rgjA	0.215	0.441	2.778E-12	463	0.052	0.114	4rgjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	751	1130	0.398	0.359	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	854	965	0.432	0.457	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	786	983	0.394	0.409	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	925	1055	0.452	0.438	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	927	946	0.449	0.484	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	944	986	0.456	0.473	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	757	918	0.380	0.423	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D3ZDH4	599	977	0.363	0.380	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
9	D3ZZK3	787	949	0.398	0.428	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
10	F1MAJ0	943	987	0.458	0.474	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
11	O08644	1868	1014	0.919	0.925	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
12	O08680	762	984	0.388	0.402	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
13	O09127	732	1004	0.392	0.398	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
14	O15197	2088	1021	1.000	1.000	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
15	O73875	769	987	0.424	0.439	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
16	O73878	778	976	0.419	0.439	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
17	P09759	963	984	0.471	0.489	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
18	P21709	602	976	0.369	0.386	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
19	P28693	960	1004	0.467	0.475	EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3
20	P29317	666	976	0.378	0.395	EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09320 DUF1977	7.1e+02	11.8	Domain of unknown function (DUF1977)
2	PF14575 EphA2_TM	6.2e-15	67.0	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	2.2e-55	199.1	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	0.0017	29.4	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	7.4e-22	88.8	Fibronectin type III domain
6	PF06946 Phage_holin_5_1	6.5e+02	12.1	Bacteriophage A118-like holin, Hol118
7	PF00069 Pkinase	1.2e-24	98.7	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	2.3e-62	222.2	Protein tyrosine and serine/threonine kinase
9	PF16656 Pur_ac_phosph_N	0.46	22.5	Purple acid Phosphatase, N-terminal domain
10	PF00536 SAM_1	1.7e-08	46.1	SAM domain (Sterile alpha motif)
11	PF07647 SAM_2	2.5e-13	61.2	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204961	0.988	Ephrin-B1
2	9606.ENSP00000245323	0.968	Ephrin-B2
3	9606.ENSP00000226091	0.945	Ephrin-B3
4	9606.ENSP00000217652	0.906	Myosin regulatory light chain 12A
5	9606.ENSP00000219070	0.904	72 kDa type IV collagenase
6	9606.ENSP00000294785	0.903	Nicastrin
7	9606.ENSP00000326366	0.902	Presenilin-1
8	9606.ENSP00000355747	0.902	Presenilin-2
9	9606.ENSP00000361405	0.902	Matrix metalloproteinase-9
10	9606.ENSP00000261879	0.900	Gamma-secretase subunit APH-1B
11	9606.ENSP00000358105	0.900	Gamma-secretase subunit APH-1A
12	9606.ENSP00000468411	0.900	Gamma-secretase subunit PEN-2
13	9606.ENSP00000357392	0.899	Ephrin-A1
14	9606.ENSP00000328777	0.876	Ephrin-A5
15	9606.ENSP00000414378	0.868	Ephrin-A4
16	9606.ENSP00000264051	0.854	Ephexin-1
17	9606.ENSP00000215368	0.853	Ephrin-A2
18	9606.ENSP00000357393	0.845	Ephrin-A3
19	9606.ENSP00000274376	0.809	Ras GTPase-activating protein 1
20	9606.ENSP00000361423	0.804	Tyrosine-protein kinase ABL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	1.000	ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.950	positive regulation of cellular process
GO:0023052	0.933	signaling
GO:0007154	0.932	cell communication
GO:0032501	0.931	multicellular organismal process
GO:0022407	0.930	regulation of cell-cell adhesion
GO:0051716	0.906	cellular response to stimulus
GO:0007165	0.888	signal transduction
GO:0045785	0.879	positive regulation of cell adhesion
GO:0051249	0.798	regulation of lymphocyte activation
GO:0032502	0.770	developmental process
GO:0048856	0.758	anatomical structure development
GO:0051240	0.750	positive regulation of multicellular organismal process
GO:0007166	0.730	cell surface receptor signaling pathway
GO:0051251	0.715	positive regulation of lymphocyte activation
GO:0002376	0.670	immune system process
GO:1903037	0.654	regulation of leukocyte cell-cell adhesion
GO:0071704	0.610	organic substance metabolic process
GO:0044238	0.598	primary metabolic process
GO:0006807	0.555	nitrogen compound metabolic process
GO:0065009	0.553	regulation of molecular function
GO:0007167	0.543	enzyme-linked receptor protein signaling pathway
GO:0007275	0.541	multicellular organism development
GO:0022409	0.541	positive regulation of cell-cell adhesion
GO:0007169	0.532	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1903039	0.512	positive regulation of leukocyte cell-cell adhesion
GO:1901564	0.509	organonitrogen compound metabolic process
GO:0046649	0.482	lymphocyte activation
GO:0070661	0.431	leukocyte proliferation
GO:0043170	0.430	macromolecule metabolic process
GO:0048731	0.428	system development
GO:0048013	0.428	ephrin receptor signaling pathway
GO:0019538	0.422	protein metabolic process
GO:0048519	0.391	negative regulation of biological process
GO:0048523	0.354	negative regulation of cellular process
GO:0044093	0.345	positive regulation of molecular function
GO:0019222	0.326	regulation of metabolic process
GO:0050870	0.314	positive regulation of T cell activation
GO:0050790	0.304	regulation of catalytic activity
GO:0060255	0.304	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005829	0.987	cytosol
GO:0005576	0.916	extracellular region
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0009986	0.392	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]