StarFunc result for job id O15198

User Input

>input (467 residues)
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ
SGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG
FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSR
NCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1P4N1	0.778	0.764	6.047E-85	476	0.908	0.891	F1P4N1.pdb.gz
2	AFDB:B2GS20	0.834	0.835	2.549E-83	466	0.831	0.833	B2GS20.pdb.gz
3	AFDB:O54835	0.712	0.760	2.582E-81	434	0.884	0.952	O54835.pdb.gz	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
4	AFDB:P97588	0.820	0.818	9.132E-80	468	0.801	0.799	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
5	AFDB:P97454	0.824	0.828	4.693E-79	465	0.784	0.787	P97454.pdb.gz	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
6	AFDB:Q9I8V2	0.772	0.764	2.873E-78	472	0.790	0.782	Q9I8V2.pdb.gz	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
7	AFDB:P42003	0.804	0.825	7.513E-74	455	0.713	0.732	P42003.pdb.gz	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
8	AFDB:P84023	0.747	0.818	4.267E-62	426	0.593	0.650	P84023.pdb.gz	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
9	AFDB:Q9I9P9	0.741	0.739	7.933E-61	468	0.591	0.590	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
10	AFDB:O96660	0.517	0.501	8.944E-56	486	0.546	0.525	O96660.pdb.gz	O96660_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Smox PE=1 SV=1
11	PDB:7dvqX	0.179	0.478	2.358E-1	156	0.030	0.090	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5nxsB	0.092	0.148	6.369E-1	251	0.032	0.060	5nxsB.pdb.gz
13	PDB:7wrgA	0.125	0.077	7.159E-1	812	0.047	0.027	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
14	PDB:6uzyA	0.058	0.092	9.045E-1	278	0.024	0.040	6uzyA.pdb.gz	Cryo-EM structures of the ATP release channel pannexin 1.
15	PDB:2kb3A	0.093	0.248	1.017	143	0.032	0.105	2kb3A.pdb.gz
16	PDB:4l02A	0.073	0.084	1.078	360	0.047	0.061	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
17	PDB:7ea3J	0.092	0.056	1.285	883	0.024	0.012	7ea3J.pdb.gz
18	PDB:3i0uB	0.069	0.108	1.362	198	0.034	0.081	3i0uB.pdb.gz
19	PDB:5nxsA	0.080	0.116	1.623	290	0.024	0.038	5nxsA.pdb.gz
20	PDB:2j04A	0.076	0.067	1.824	587	0.071	0.056	2j04A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QXZ9	787	466	0.833	0.835	F1QXZ9_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=sma8 PE=3 SV=1
2	O15198	970	467	1.000	1.000	SMAD9_HUMAN Mothers against decapentaplegic homolog 9 OS=Homo sapiens OX=9606 GN=SMAD9 PE=1 SV=1
3	O54835	793	434	0.882	0.949	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
4	P42003	671	455	0.715	0.734	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
5	P70340	749	465	0.805	0.809	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
6	P84022	521	425	0.600	0.659	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
7	P84023	517	426	0.591	0.648	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
8	P84025	521	425	0.600	0.659	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
9	P97454	724	465	0.784	0.787	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
10	P97588	747	468	0.801	0.799	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
11	Q15797	753	465	0.812	0.815	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
12	Q56I98	827	476	0.906	0.889	Q56I98_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD8 PE=2 SV=1
13	Q56I99	716	465	0.784	0.787	SMAD5_CHICK Mothers against decapentaplegic homolog 5 OS=Gallus gallus OX=9031 GN=SMAD5 PE=1 SV=1
14	Q56IA0	751	465	0.803	0.806	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
15	Q68DB7	725	465	0.786	0.789	Q68DB7_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=DKFZp781O1323 PE=2 SV=1
16	Q8AY15	518	425	0.595	0.654	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1
17	Q8AY16	514	423	0.589	0.650	Q8AY16_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zgc:92234 PE=2 SV=1
18	Q8BUN5	521	425	0.600	0.659	SMAD3_MOUSE Mothers against decapentaplegic homolog 3 OS=Mus musculus OX=10090 GN=Smad3 PE=1 SV=2
19	Q99717	725	465	0.786	0.789	SMAD5_HUMAN Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1
20	Q9I8V2	713	472	0.782	0.773	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13978 DUF4223	29	16.0	Protein of unknown function (DUF4223)
2	PF10401 IRF-3	8.7	17.6	Interferon-regulatory factor 3
3	PF03165 MH1	7.6e-39	143.4	MH1 domain
4	PF03166 MH2	1.1e-66	235.9	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369154

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341551	0.995	Mothers against decapentaplegic homolog 4
2	9606.ENSP00000263640	0.982	Activin receptor type-1
3	9606.ENSP00000245451	0.981	Bone morphogenetic protein 4
4	9606.ENSP00000363708	0.980	Bone morphogenetic protein receptor type-2
5	9606.ENSP00000368104	0.978	Bone morphogenetic protein 2
6	9606.ENSP00000401907	0.977	Bone morphogenetic protein receptor type-1B
7	9606.ENSP00000361107	0.976	Bone morphogenetic protein receptor type-1A
8	9606.ENSP00000364133	0.974	TGF-beta receptor type-1
9	9606.ENSP00000340361	0.971	Activin receptor type-2B
10	9606.ENSP00000373574	0.970	Serine/threonine-protein kinase receptor R3
11	9606.ENSP00000241416	0.968	Activin receptor type-2A
12	9606.ENSP00000379204	0.968	Bone morphogenetic protein 7
13	9606.ENSP00000463051	0.968	Growth/differentiation factor 2
14	9606.ENSP00000332973	0.964	Mothers against decapentaplegic homolog 3
15	9606.ENSP00000354621	0.962	E3 ubiquitin-protein ligase SMURF1
16	9606.ENSP00000362299	0.959	Endoglin
17	9606.ENSP00000262435	0.956	E3 ubiquitin-protein ligase SMURF2
18	9606.ENSP00000221930	0.955	Transforming growth factor beta-1
19	9606.ENSP00000238682	0.954	Transforming growth factor beta-3
20	9606.ENSP00000351905	0.950	TGF-beta receptor type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.970	organic cyclic compound binding
GO:1901363	0.960	heterocyclic compound binding
GO:0003677	0.954	DNA binding
GO:0000976	0.927	transcription cis-regulatory region binding
GO:0000977	0.896	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.826	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.809	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.540	transcription regulator activity
GO:0003700	0.420	DNA-binding transcription factor activity
GO:0000981	0.366	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.992	cellular process
GO:0009893	0.990	positive regulation of metabolic process
GO:0050896	0.989	response to stimulus
GO:0048856	0.987	anatomical structure development
GO:0009889	0.985	regulation of biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0032501	0.984	multicellular organismal process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0071363	0.981	cellular response to growth factor stimulus
GO:0048522	0.979	positive regulation of cellular process
GO:0007166	0.976	cell surface receptor signaling pathway
GO:0007178	0.973	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048523	0.971	negative regulation of cellular process
GO:0007275	0.949	multicellular organism development
GO:0031325	0.941	positive regulation of cellular metabolic process
GO:0051173	0.937	positive regulation of nitrogen compound metabolic process
GO:0010604	0.935	positive regulation of macromolecule metabolic process
GO:0071772	0.921	response to BMP
GO:0045935	0.874	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.871	positive regulation of cellular biosynthetic process
GO:0010557	0.869	positive regulation of macromolecule biosynthetic process
GO:0051254	0.840	positive regulation of RNA metabolic process
GO:0045893	0.828	positive regulation of DNA-templated transcription
GO:0009892	0.736	negative regulation of metabolic process
GO:0071773	0.725	cellular response to BMP stimulus
GO:0030509	0.723	BMP signaling pathway
GO:0010605	0.690	negative regulation of macromolecule metabolic process
GO:0030154	0.669	cell differentiation
GO:0031324	0.512	negative regulation of cellular metabolic process
GO:0006357	0.489	regulation of transcription by RNA polymerase II
GO:0051172	0.477	negative regulation of nitrogen compound metabolic process
GO:0010558	0.473	negative regulation of macromolecule biosynthetic process
GO:0031327	0.473	negative regulation of cellular biosynthetic process
GO:0045934	0.470	negative regulation of nucleobase-containing compound metabolic process
GO:0044237	0.444	cellular metabolic process
GO:0045944	0.444	positive regulation of transcription by RNA polymerase II
GO:0048731	0.434	system development
GO:0048513	0.423	animal organ development
GO:0045892	0.420	negative regulation of DNA-templated transcription
GO:0048583	0.419	regulation of response to stimulus
GO:0010646	0.419	regulation of cell communication
GO:0023051	0.418	regulation of signaling
GO:0009966	0.410	regulation of signal transduction
GO:0071704	0.408	organic substance metabolic process
GO:0050793	0.406	regulation of developmental process
GO:0044238	0.390	primary metabolic process
GO:0006807	0.373	nitrogen compound metabolic process
GO:0043170	0.353	macromolecule metabolic process
GO:0051094	0.343	positive regulation of developmental process
GO:0009653	0.309	anatomical structure morphogenesis
GO:0009888	0.308	tissue development
GO:1901564	0.307	organonitrogen compound metabolic process
GO:0045595	0.304	regulation of cell differentiation
GO:0042221	0.303	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.997	cytoplasm
GO:0070013	0.984	intracellular organelle lumen
GO:0031981	0.785	nuclear lumen
GO:0032991	0.762	protein-containing complex
GO:0005654	0.726	nucleoplasm
GO:0005829	0.531	cytosol
GO:0071944	0.444	cell periphery
GO:0016020	0.373	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]