StarFunc result for job id O15211

User Input

>input (777 residues)
MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDE
EEDGAVFTVTSRQYRPLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAF
LATHRAFTSTPALLGLMADRLEALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKG
QLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSRVDPQAPDLPKPLALPGDPPADPTDVL
VFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
VVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQS
SPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPR
SGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRGY
NLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSV
GVPTPLVSCDRPSTGGDEAPTTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSH
LSPPASSPRPSRGHRRSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCRIIRVQMELGE
DGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYA
MDGASHDFLLRQRRRSSTATPGVTSGPSASGTPPSEGGGGSFPRIKATGRKIARALF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15211	1.000	1.000	0.000	777	1.000	1.000	O15211.pdb.gz	RGL2_HUMAN Ral guanine nucleotide dissociation stimulator-like 2 OS=Homo sapiens OX=9606 GN=RGL2 PE=1 SV=1
2	AFDB:Q61193	0.816	0.815	2.101E-95	778	0.900	0.898	Q61193.pdb.gz	RGL2_MOUSE Ral guanine nucleotide dissociation stimulator-like 2 OS=Mus musculus OX=10090 GN=Rgl2 PE=1 SV=2
3	AFDB:Q3UYI5	0.473	0.515	1.081E-41	709	0.349	0.382	Q3UYI5.pdb.gz	RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus OX=10090 GN=Rgl3 PE=1 SV=2
4	AFDB:Q9U4U5	0.455	0.375	1.905E-36	954	0.293	0.239	Q9U4U5.pdb.gz	Q9U4U5_DROME LD16082p OS=Drosophila melanogaster OX=7227 GN=Rgl PE=2 SV=1
5	AFDB:Q07889	0.416	0.250	1.252E-14	1333	0.181	0.106	Q07889.pdb.gz	SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1
6	AFDB:F1R019	0.418	0.248	5.762E-14	1341	0.192	0.111	F1R019.pdb.gz	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
7	AFDB:Q5JS13	0.302	0.415	1.016E-13	557	0.142	0.197	Q5JS13.pdb.gz	RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens OX=9606 GN=RALGPS1 PE=1 SV=1
8	AFDB:F1M8L9	0.431	0.272	1.108E-13	1253	0.158	0.098	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
9	PDB:2byvE	0.433	0.369	7.048E-13	922	0.104	0.088	2byvE.pdb.gz
10	AFDB:Q0E949	0.297	0.327	2.058E-12	702	0.142	0.157	Q0E949.pdb.gz	Q0E949_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=RalGPS PE=4 SV=1
11	PDB:4f7zA	0.424	0.351	2.870E-11	946	0.100	0.082	4f7zA.pdb.gz
12	AFDB:E3M3V1	0.081	0.081	3.596E-3	779	0.126	0.126	E3M3V1.pdb.gz	PGL1_CAERE Guanyl-specific ribonuclease pgl-1 OS=Caenorhabditis remanei OX=31234 GN=pgl-1 PE=1 SV=1
13	PDB:6mdhA	0.086	0.379	2.607E-2	149	0.009	0.047	6mdhA.pdb.gz
14	PDB:3dbhI	0.095	0.689	3.695E-2	86	0.019	0.174	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:7rbsB	0.090	0.360	3.860E-2	157	0.009	0.045	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:4tnmA	0.099	0.163	4.595E-2	407	0.069	0.133	4tnmA.pdb.gz
17	PDB:4rm8A	0.090	0.177	4.800E-2	368	0.009	0.019	4rm8A.pdb.gz
18	PDB:3plvA	0.080	0.520	5.715E-2	80	0.012	0.113	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:4pyuA	0.087	0.695	5.715E-2	76	0.006	0.066	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
20	PDB:6rpqA	0.080	0.209	5.715E-2	249	0.012	0.036	6rpqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15211	0.0	1552	777	1.000	1.000	RGL2_HUMAN Ral guanine nucleotide dissociation stimulator-like 2 OS=Homo sapiens OX=9606 GN=RGL2 PE=1 SV=1
2	Q61193	0.0	1278	778	0.884	0.883	RGL2_MOUSE Ral guanine nucleotide dissociation stimulator-like 2 OS=Mus musculus OX=10090 GN=Rgl2 PE=1 SV=2
3	Q9NZL6	1.59e-115	369	768	0.335	0.339	RGL1_HUMAN Ral guanine nucleotide dissociation stimulator-like 1 OS=Homo sapiens OX=9606 GN=RGL1 PE=1 SV=1
4	Q12967	1.79e-114	370	914	0.296	0.252	GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens OX=9606 GN=RALGDS PE=1 SV=2
5	Q3UYI5	3.69e-92	305	709	0.272	0.298	RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus OX=10090 GN=Rgl3 PE=1 SV=2
6	Q03385	5.11e-87	295	852	0.181	0.165	GNDS_MOUSE Ral guanine nucleotide dissociation stimulator OS=Mus musculus OX=10090 GN=Ralgds PE=1 SV=2
7	Q3MIN7	5.72e-87	291	710	0.265	0.290	RGL3_HUMAN Ral guanine nucleotide dissociation stimulator-like 3 OS=Homo sapiens OX=9606 GN=RGL3 PE=1 SV=2
8	Q03386	1.62e-81	281	895	0.176	0.153	GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus OX=10116 GN=Ralgds PE=1 SV=1
9	Q86BI2	1.45e-62	226	774	0.230	0.231	Q86BI2_DROME RE29964p OS=Drosophila melanogaster OX=7227 GN=Rgl PE=2 SV=1
10	Q9GR11	1.46e-62	226	774	0.230	0.231	Q9GR11_DROME Ral guanine nucleotide dissociation stimulator-like protein OS=Drosophila melanogaster OX=7227 GN=Rgl PE=2 SV=1
11	Q9U4U5	1.41e-61	226	954	0.230	0.188	Q9U4U5_DROME LD16082p OS=Drosophila melanogaster OX=7227 GN=Rgl PE=2 SV=1
12	M9PCE9	1.61e-61	226	973	0.230	0.184	M9PCE9_DROME Ral guanine nucleotide dissociation stimulator-like, isoform E OS=Drosophila melanogaster OX=7227 GN=Rgl PE=4 SV=1
13	G4SFM6	2.97e-54	203	860	0.192	0.173	G4SFM6_CAEEL Ral guanine nucleotide dissociation stimulator-like 1 OS=Caenorhabditis elegans OX=6239 GN=rgl-1 PE=1 SV=2
14	Q19852	4.32e-54	203	880	0.192	0.169	Q19852_CAEEL Ral guanine nucleotide dissociation stimulator-like 1 OS=Caenorhabditis elegans OX=6239 GN=rgl-1 PE=1 SV=3
15	Q54PQ4	9.97e-29	124	605	0.135	0.174	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
16	F1R019	1.36e-27	122	1341	0.143	0.083	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
17	P43069	8.14e-27	120	1333	0.151	0.088	CDC25_CANAL Cell division control protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC25 PE=1 SV=2
18	Q8SSQ0	9.69e-26	116	1721	0.127	0.058	GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum OX=44689 GN=gefR PE=1 SV=1
19	P70392	2.42e-24	112	1189	0.120	0.078	RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus OX=10090 GN=Rasgrf2 PE=1 SV=2
20	Q99JE4	3.31e-24	111	1190	0.120	0.078	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00788 RA	7.1e-09	47.5	Ras association (RalGDS/AF-6) domain
2	PF00617 RasGEF	7.1e-46	168.2	RasGEF domain
3	PF00618 RasGEF_N	1.4e-10	52.7	RasGEF N-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407586	0.958	GTPase HRas
2	9606.ENSP00000005257	0.950	Ras-related protein Ral-A
3	9606.ENSP00000272519	0.938	Ras-related protein Ral-B
4	9606.ENSP00000256078	0.890	GTPase KRas
5	9606.ENSP00000246792	0.880	Ras-related protein R-Ras
6	9606.ENSP00000256196	0.873	Ras-related protein R-Ras2
7	9606.ENSP00000358548	0.860	GTPase NRas
8	9606.ENSP00000289104	0.856	Ras-related protein M-Ras
9	9606.ENSP00000393963	0.830	Kinesin-like protein KIFC1
10	9606.ENSP00000378563	0.787	Prefoldin subunit 6
11	9606.ENSP00000363794	0.780	Estradiol 17-beta-dehydrogenase 8
12	9606.ENSP00000363809	0.779	Zinc transporter SLC39A7
13	9606.ENSP00000393241	0.774	40S ribosomal protein S18
14	9606.ENSP00000363840	0.760	Collagen alpha-2(XI) chain
15	9606.ENSP00000363817	0.745	Retinoic acid receptor RXR-beta
16	9606.ENSP00000363640	0.708	PHD finger protein 1
17	9606.ENSP00000404833	0.700	Tapasin
18	9606.ENSP00000441000	0.681	Valine--tRNA ligase, mitochondrial
19	9606.ENSP00000359484	0.648	Stromal membrane-associated protein 1
20	9606.ENSP00000359685	0.616	Protein tyrosine phosphatase type IVA 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048519	0.958	negative regulation of biological process
GO:0048522	0.940	positive regulation of cellular process
GO:0010646	0.916	regulation of cell communication
GO:0048523	0.910	negative regulation of cellular process
GO:0023051	0.876	regulation of signaling
GO:0009966	0.867	regulation of signal transduction
GO:0009987	0.858	cellular process
GO:0010660	0.857	regulation of muscle cell apoptotic process
GO:0014066	0.855	regulation of phosphatidylinositol 3-kinase signaling
GO:0051056	0.840	regulation of small GTPase mediated signal transduction
GO:0010647	0.798	positive regulation of cell communication
GO:0009967	0.775	positive regulation of signal transduction
GO:0046578	0.745	regulation of Ras protein signal transduction
GO:0060548	0.710	negative regulation of cell death
GO:0010656	0.695	negative regulation of muscle cell apoptotic process
GO:0010665	0.681	regulation of cardiac muscle cell apoptotic process
GO:0010664	0.681	negative regulation of striated muscle cell apoptotic process
GO:1902533	0.668	positive regulation of intracellular signal transduction
GO:0010667	0.631	negative regulation of cardiac muscle cell apoptotic process
GO:0050896	0.609	response to stimulus
GO:0014068	0.599	positive regulation of phosphatidylinositol 3-kinase signaling
GO:0051716	0.545	cellular response to stimulus
GO:0007165	0.412	signal transduction
GO:0035556	0.304	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.356	membrane
GO:0043227	0.333	membrane-bounded organelle
GO:0043231	0.323	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]