StarFunc result for job id O15212

User Input

>input (129 residues)
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQA
AKAGAPGKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15212	1.000	1.000	6.363E-18	129	1.000	1.000	O15212.pdb.gz	PFD6_HUMAN Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1
2	AFDB:Q2HIK4	0.916	0.916	9.513E-10	129	0.426	0.426	Q2HIK4.pdb.gz	PFD6_ARATH Prefoldin subunit 6 OS=Arabidopsis thaliana OX=3702 GN=PFD6 PE=1 SV=1
3	AFDB:P52554	0.891	0.911	1.200E-8	126	0.388	0.397	P52554.pdb.gz	PFD6_CAEEL Probable prefoldin subunit 6 OS=Caenorhabditis elegans OX=6239 GN=pfd-6 PE=2 SV=1
4	AFDB:P52553	0.770	0.865	1.334E-7	114	0.380	0.430	P52553.pdb.gz	PFD6_YEAST Prefoldin subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKE2 PE=1 SV=1
5	AFDB:O14450	0.610	0.689	8.932E-7	114	0.349	0.395	O14450.pdb.gz	PFD6_SCHPO Probable prefoldin subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A11.13 PE=3 SV=1
6	PDB:2zdiB	0.558	0.674	2.205E-5	106	0.194	0.236	2zdiB.pdb.gz
7	AFDB:O58268	0.551	0.604	3.107E-5	117	0.217	0.239	O58268.pdb.gz	PFDB_PYRHO Prefoldin subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdB PE=1 SV=1
8	AFDB:Q9N5M2	0.760	0.699	9.721E-5	141	0.194	0.177	Q9N5M2.pdb.gz	PFD2_CAEEL Prefoldin subunit 2 OS=Caenorhabditis elegans OX=6239 GN=pfd-2 PE=3 SV=1
9	AFDB:Q94AF7	0.794	0.800	1.832E-4	128	0.178	0.180	Q94AF7.pdb.gz	PFD1_ARATH Prefoldin subunit 1 OS=Arabidopsis thaliana OX=3702 GN=PFD1 PE=1 SV=1
10	AFDB:Q17827	0.701	0.764	2.080E-4	117	0.155	0.171	Q17827.pdb.gz	PFD1_CAEEL Probable prefoldin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pfd-1 PE=2 SV=1
11	AFDB:O14334	0.806	0.922	3.042E-4	112	0.155	0.179	O14334.pdb.gz	PFD1_SCHPO Probable prefoldin subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1D7.01 PE=3 SV=1
12	PDB:2zdiC	0.639	0.568	1.053E-3	148	0.233	0.203	2zdiC.pdb.gz
13	PDB:7n6g3I	0.554	0.185	1.824E-2	401	0.186	0.060	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7sqcO1	0.415	0.123	5.357E-2	673	0.178	0.034	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7aqcR	0.367	0.126	1.146E-1	558	0.132	0.030	7aqcR.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
16	PDB:2w6gG	0.497	0.461	1.386E-1	140	0.155	0.143	2w6gG.pdb.gz
17	PDB:6z6oC	0.370	0.096	2.160E-1	548	0.163	0.038	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
18	PDB:7rroA0	0.694	0.416	2.612E-1	221	0.140	0.081	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:6tuyA	0.652	0.133	2.783E-1	667	0.078	0.015	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
20	PDB:3k29A	0.452	0.387	3.821E-1	162	0.124	0.099	3k29A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15212	4.99e-87	251	129	1.000	1.000	PFD6_HUMAN Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1
2	Q17Q89	3.44e-86	248	129	0.992	0.992	PFD6_BOVIN Prefoldin subunit 6 OS=Bos taurus OX=9913 GN=PFDN6 PE=2 SV=1
3	Q2HIK4	7.15e-28	101	129	0.426	0.426	PFD6_ARATH Prefoldin subunit 6 OS=Arabidopsis thaliana OX=3702 GN=PFD6 PE=1 SV=1
4	P52554	6.51e-25	93.6	126	0.357	0.365	PFD6_CAEEL Probable prefoldin subunit 6 OS=Caenorhabditis elegans OX=6239 GN=pfd-6 PE=2 SV=1
5	P52553	1.20e-20	82.4	114	0.380	0.430	PFD6_YEAST Prefoldin subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKE2 PE=1 SV=1
6	O14450	3.24e-14	65.9	114	0.279	0.316	PFD6_SCHPO Probable prefoldin subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A11.13 PE=3 SV=1
7	Q4G0A0	0.039	35.4	927	0.186	0.026	Q4G0A0_DANRE Vacuolar protein sorting-associated protein 11 homolog OS=Danio rerio OX=7955 GN=zgc:112329 PE=1 SV=1
8	G9L8C4	0.25	33.1	1251	0.109	0.011	G9L8C4_DROME TRPA1(A) isoform OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=1
9	Q7Z020	0.25	33.1	1197	0.109	0.012	TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4
10	Q382R3	0.76	30.8	145	0.240	0.214	Q382R3_TRYB2 Prefoldin subunit 2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4520 PE=3 SV=1
11	E9PSY8	0.79	31.6	873	0.178	0.026	E9PSY8_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=3
12	A0A8I6ALY1	0.97	31.2	847	0.178	0.027	A0A8I6ALY1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
13	C1P640	1.1	31.2	3683	0.202	0.007	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
14	C1P641	1.1	31.2	3663	0.202	0.007	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
15	F7E540	1.1	31.2	909	0.155	0.022	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2
16	G5EEV6	1.1	31.2	3704	0.202	0.007	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
17	Q21313	1.1	31.2	3672	0.202	0.007	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
18	O24585	2.1	30.4	901	0.109	0.016	CRI4_MAIZE Putative receptor protein kinase CRINKLY4 OS=Zea mays OX=4577 GN=CR4 PE=2 SV=1
19	Q6ZT98	2.7	30.0	887	0.147	0.021	TTLL7_HUMAN Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=2
20	Q2PJ74	2.8	30.0	1145	0.124	0.014	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	41	15.7	Afadin- and alpha -actinin-Binding
2	PF13949 ALIX_LYPXL_bnd	1.5e+02	13.1	ALIX V-shaped domain binding to HIV
3	PF17675 APG6_N	11	17.9	Apg6 coiled-coil region
4	PF08647 BRE1	1.1e+02	14.3	BRE1 E3 ubiquitin ligase
5	PF09862 DUF2089	4.2e+02	12.4	Protein of unknown function (DUF2089)
6	PF13870 DUF4201	1.6e+02	13.4	Domain of unknown function (DUF4201)
7	PF14362 DUF4407	9.3e+02	10.5	Domain of unknown function (DUF4407)
8	PF04859 DUF641	2.9e+02	13.2	Plant protein of unknown function (DUF641)
9	PF19445 eIF3h_C	5.9e+02	11.5	C-terminal region of eIF3h
10	PF05377 FlaC_arch	7.2e+02	12.0	Flagella accessory protein C (FlaC)
11	PF02050 FliJ	8e+02	11.6	Flagellar FliJ protein
12	PF13851 GAS	62	14.4	Growth-arrest specific micro-tubule binding
13	PF18595 Nuf2_DHR10-like	1.4e+02	13.9	Nuf2, DHR10-like domain
14	PF07303 Occludin_ELL	25	17.0	Occludin homology domain
15	PF03938 OmpH	2.3e+02	13.5	Outer membrane protein (OmpH-like)
16	PF02996 Prefoldin	0.39	22.1	Prefoldin subunit
17	PF01920 Prefoldin_2	1.3e-22	91.1	Prefoldin subunit
18	PF13758 Prefoldin_3	1.9e+02	13.5	Prefoldin subunit
19	PF08286 Spc24	9.2e+02	11.5	Spc24 subunit of Ndc80
20	PF09728 Taxilin	7e+02	10.8	Myosin-like coiled-coil protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008329

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016988	0.999	Prefoldin subunit 2
2	61853.ENSNLEP00000021490	0.999	Prefoldin subunit 5
3	61853.ENSNLEP00000011224	0.998	Prefoldin subunit 1
4	61853.ENSNLEP00000017635	0.998	Prefoldin subunit 3
5	61853.ENSNLEP00000008561	0.996	Prefoldin subunit 4
6	61853.ENSNLEP00000005749	0.922	Bardet-Biedl syndrome 10
7	61853.ENSNLEP00000004197	0.905	Ubiquitously-expressed, prefoldin-like chaperone
8	61853.ENSNLEP00000013680	0.846	T-complex 1
9	61853.ENSNLEP00000009248	0.815	URI1, prefoldin-like chaperone
10	61853.ENSNLEP00000011878	0.799	T-complex protein 1 subunit delta
11	61853.ENSNLEP00000021761	0.795	RNA polymerase II associated protein 3
12	61853.ENSNLEP00000004035	0.794	Chaperonin containing TCP1 subunit 8
13	61853.ENSNLEP00000004793	0.784	Chaperonin containing TCP1 subunit 2
14	61853.ENSNLEP00000011809	0.780	P53 and DNA-damage regulated 1
15	61853.ENSNLEP00000012817	0.777	Chaperonin containing TCP1 subunit 7
16	61853.ENSNLEP00000015267	0.765	T-complex protein 1 subunit gamma
17	61853.ENSNLEP00000019098	0.755	Chaperonin containing TCP1 subunit 6A
18	61853.ENSNLEP00000023074	0.746	Programmed cell death 5
19	61853.ENSNLEP00000001458	0.732	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
20	61853.ENSNLEP00000018642	0.728	Magnesium-dependent phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	0.998	unfolded protein binding
GO:0051087	0.988	chaperone binding
GO:0001540	0.988	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0006457	0.987	protein folding
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0048523	0.981	negative regulation of cellular process
GO:1902903	0.967	regulation of supramolecular fiber organization
GO:0071840	0.928	cellular component organization or biogenesis
GO:0016043	0.920	cellular component organization
GO:1902904	0.917	negative regulation of supramolecular fiber organization
GO:0044085	0.649	cellular component biogenesis
GO:0009892	0.620	negative regulation of metabolic process
GO:0010605	0.604	negative regulation of macromolecule metabolic process
GO:0051246	0.582	regulation of protein metabolic process
GO:0008152	0.536	metabolic process
GO:0071704	0.507	organic substance metabolic process
GO:0051172	0.494	negative regulation of nitrogen compound metabolic process
GO:0051248	0.478	negative regulation of protein metabolic process
GO:0044238	0.464	primary metabolic process
GO:0044237	0.458	cellular metabolic process
GO:0006807	0.456	nitrogen compound metabolic process
GO:0065003	0.420	protein-containing complex assembly
GO:0043170	0.405	macromolecule metabolic process
GO:0034641	0.308	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.990	cytosol
GO:0032991	0.983	protein-containing complex
GO:0043226	0.703	organelle
GO:0043227	0.664	membrane-bounded organelle
GO:0005634	0.650	nucleus
GO:0070013	0.597	intracellular organelle lumen
GO:0031981	0.557	nuclear lumen
GO:0005654	0.529	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]