StarFunc result for job id O15226

User Input

>input (690 residues)
MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPV
HFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGF
ILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTAT
IWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGY
ACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRIEVRVVRRKFKHTFGEDLVVCQI
GMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWTNFVITENANDAIGILNNSASFN
KMSIEYKYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKILQKTQPTYPSVK
SSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKC
KVILESEVIAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRS
AEEAYKQQIKEDNIGNQLLRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNK
IAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVV
GRKRRKEDLLDQLKQEGQVGHYELVMPQAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3F769	0.643	0.643	0.000	690	1.000	1.000	A3F769.pdb.gz	A3F769_HUMAN NF-kappaB repressing factor OS=Homo sapiens OX=9606 GN=NRF PE=2 SV=1
2	AFDB:Q9NXV6	0.203	0.239	5.004E-13	580	0.114	0.136	Q9NXV6.pdb.gz	CARF_HUMAN CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3
3	PDB:7zpkC	0.109	0.269	3.821E-8	233	0.065	0.193	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
4	PDB:8dfvK	0.090	0.232	4.295E-6	253	0.071	0.194	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
5	PDB:7v6cB	0.102	0.249	7.346E-6	260	0.067	0.177	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
6	PDB:8dgaK	0.086	0.301	6.995E-5	182	0.061	0.231	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
7	PDB:7l08c	0.088	0.196	4.851E-3	289	0.019	0.045	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
8	AFDB:O74363	0.096	0.095	2.771E-2	695	0.128	0.127	O74363.pdb.gz	YND2_SCHPO G-patch and R3H domain-containing protein C30B4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30B4.02c PE=4 SV=1
9	PDB:7yz4A	0.092	0.052	8.795E-2	1234	0.020	0.011	7yz4A.pdb.gz
10	AFDB:Q57VI0	0.053	0.051	1.004E-1	768	0.078	0.070	Q57VI0.pdb.gz	Q57VI0_TRYB2 Serine/threonine-protein kinase PLK OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.640 PE=3 SV=1
11	PDB:3j6b5	0.075	0.144	1.150E-1	326	0.036	0.077	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
12	PDB:7yymA	0.085	0.047	1.504E-1	1281	0.020	0.011	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
13	PDB:6y2pA	0.085	0.128	1.587E-1	355	0.048	0.093	6y2pA.pdb.gz
14	PDB:8dgaA	0.085	0.037	1.767E-1	1629	0.019	0.008	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
15	AFDB:Q54I36	0.056	0.036	1.912E-1	1338	0.099	0.051	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
16	AFDB:Q14159	0.065	0.053	5.023E-1	915	0.093	0.070	Q14159.pdb.gz	SPIDR_HUMAN DNA repair-scaffolding protein OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=2
17	AFDB:Q5A1E0	0.060	0.044	5.300E-1	1308	0.062	0.033	Q5A1E0.pdb.gz	IFF5_CANAL Cell wall protein IFF5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF5 PE=1 SV=1
18	AFDB:Q6DN12	0.065	0.054	5.592E-1	878	0.075	0.059	Q6DN12.pdb.gz	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
19	AFDB:Q54KJ1	0.061	0.067	1.009	612	0.122	0.137	Q54KJ1.pdb.gz	Y7317_DICDI Uncharacterized protein DDB_G0287317 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287317 PE=4 SV=1
20	AFDB:P25653	0.050	0.029	1.185	1609	0.071	0.030	P25653.pdb.gz	FIG2_YEAST Factor-induced gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3F769	0.0	1446	690	1.000	1.000	A3F769_HUMAN NF-kappaB repressing factor OS=Homo sapiens OX=9606 GN=NRF PE=2 SV=1
2	O15226	0.0	1446	690	1.000	1.000	NKRF_HUMAN NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2
3	Q5XJR4	1.43e-16	83.6	312	0.078	0.173	Q5XJR4_DANRE CDKN2A-interacting protein OS=Danio rerio OX=7955 GN=CARF PE=1 SV=1
4	F1QZX8	1.62e-16	83.2	312	0.078	0.173	F1QZX8_DANRE CDKN2A-interacting protein OS=Danio rerio OX=7955 GN=zgc:101658 PE=1 SV=1
5	Q8BI72	4.25e-11	68.6	563	0.088	0.108	CARF_MOUSE CDKN2A-interacting protein OS=Mus musculus OX=10090 GN=Cdkn2aip PE=1 SV=1
6	Q9NXV6	9.20e-11	67.4	580	0.074	0.088	CARF_HUMAN CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3
7	M0R2Z9	6.40e-07	55.5	1096	0.038	0.024	M0R2Z9_HUMAN SURP and G-patch domain containing 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=1
8	Q8IX01	6.78e-07	55.5	1082	0.038	0.024	SUGP2_HUMAN SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=2
9	F4JCU0	9.77e-07	54.7	1007	0.035	0.024	SUA_ARATH SUPPRESSOR OF ABI3-5 OS=Arabidopsis thaliana OX=3702 GN=SUA PE=1 SV=2
10	Q9NW75	1.25e-06	53.9	528	0.038	0.049	GPTC2_HUMAN G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1
11	Q147M4	1.38e-05	50.1	301	0.033	0.076	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
12	Q9SLC6	4.24e-05	49.3	752	0.071	0.065	STIP2_ARATH Septin and tuftelin-interacting protein 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=STIPL2 PE=2 SV=1
13	Q08CK9	1.19e-04	47.8	774	0.032	0.028	Q08CK9_DANRE Angiogenic factor with G patch and FHA domains 1 OS=Danio rerio OX=7955 GN=zgc:152959 PE=2 SV=1
14	Q8CGZ0	3.00e-04	46.6	936	0.048	0.035	CHERP_MOUSE Calcium homeostasis endoplasmic reticulum protein OS=Mus musculus OX=10090 GN=Cherp PE=1 SV=1
15	D3ZAX5	3.09e-04	46.6	946	0.048	0.035	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
16	Q8IWZ8	3.51e-04	46.2	645	0.035	0.037	SUGP1_HUMAN SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2
17	Q8IWX8	4.98e-04	45.8	916	0.046	0.035	CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3
18	P52756	6.05e-04	45.4	815	0.033	0.028	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
19	A2A6A1	6.77e-04	45.4	1505	0.041	0.019	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
20	Q9UKJ3	0.001	45.1	1502	0.041	0.019	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00035 dsrm	0.21	23.7	Double-stranded RNA binding motif
2	PF01585 G-patch	1.5e-10	52.1	G-patch domain
3	PF12656 G-patch_2	0.0099	27.3	G-patch domain
4	PF01424 R3H	1.3e-08	46.0	R3H domain
5	PF16470 S8_pro-domain	1.5e+02	14.3	Peptidase S8 pro-domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003812668.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003826881.1	0.921	DEAH-box helicase 15
2	9597.XP_003815411.1	0.708	Belongs to the DEAD box helicase family.
3	9597.XP_003804705.1	0.695	Tripartite motif containing 21
4	9597.XP_008970529.1	0.682	BTB/POZ domain-containing protein 9 isoform X1
5	9597.XP_003813517.1	0.681	Mesoderm-specific transcript homolog protein isoform X1
6	9597.XP_003821915.1	0.680	Belongs to the G-protein coupled receptor 1 family.
7	9597.XP_003829460.1	0.676	Glycoprotein IX platelet
8	9597.XP_003809635.1	0.675	Kelch-like ECH-associated protein 1 isoform X1
9	9597.XP_003823249.1	0.675	acyl-CoA thioesterase 13
10	9597.XP_003816079.1	0.668	Belongs to the ligand-gated ion channel (TC 1.A.9) family.
11	9597.XP_008969282.1	0.665	Growth differentiation factor 15
12	9597.XP_008951253.1	0.662	A-kinase anchoring protein 7
13	9597.XP_003816551.1	0.656	Epithelial membrane protein 1
14	9597.XP_008952685.1	0.646	Zinc finger protein 300 isoform X1
15	9597.XP_003809584.1	0.623	Potassium voltage-gated channel subfamily KQT member 5 isoform X1
16	9597.XP_003823043.1	0.602	Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
17	9597.XP_008957447.1	0.583	Ankyrin repeat domain-containing protein SOWAHC
18	9597.XP_003809119.1	0.569	DDB1- and CUL4-associated factor 11 isoform X1
19	9597.XP_008963940.1	0.556	IQ motif containing with AAA domain 1
20	9597.XP_008958287.1	0.553	Serine/threonine kinase 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0140110	0.996	transcription regulator activity
GO:0003677	0.996	DNA binding
GO:0000981	0.917	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.890	sequence-specific double-stranded DNA binding
GO:0001216	0.884	DNA-binding transcription activator activity
GO:0001067	0.861	transcription regulatory region nucleic acid binding
GO:0098772	0.852	molecular function regulator activity
GO:0000976	0.852	transcription cis-regulatory region binding
GO:0000987	0.820	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.793	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.781	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0060590	0.764	ATPase regulator activity
GO:0000978	0.499	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001671	0.428	ATPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048519	0.997	negative regulation of biological process
GO:0010468	0.997	regulation of gene expression
GO:0048522	0.996	positive regulation of cellular process
GO:0010557	0.995	positive regulation of macromolecule biosynthetic process
GO:0051172	0.993	negative regulation of nitrogen compound metabolic process
GO:0031324	0.992	negative regulation of cellular metabolic process
GO:0010605	0.990	negative regulation of macromolecule metabolic process
GO:0045944	0.988	positive regulation of transcription by RNA polymerase II
GO:0045934	0.983	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.971	negative regulation of DNA-templated transcription
GO:0009987	0.757	cellular process
GO:0050896	0.491	response to stimulus
GO:0071704	0.473	organic substance metabolic process
GO:0006807	0.411	nitrogen compound metabolic process
GO:0044237	0.394	cellular metabolic process
GO:0044238	0.367	primary metabolic process
GO:0034641	0.324	cellular nitrogen compound metabolic process
GO:0043170	0.319	macromolecule metabolic process
GO:0006950	0.305	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005737	0.422	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]