StarFunc result for job id O15228

User Input

>input (680 residues)
MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKFAMKCYTPLVY
KGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLREEVSEILDEMSHKLRLGAIR
FCAFTLSKVFKQIFSKVCVNEEGIQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNYDL
PVPVIAAGMDFLGMKMVGELLRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRNGYAPVEF
FLEGTRSRSAKTLTPKFGLLNIVMEPFFKREVFDTYLVPISISYDKILEETLYVYELLGV
PKPKESTTGLLKARKILSENFGSIHVYFGDPVSLRSLAAGRMSRSSYNLVPRYIPQKQSE
DMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFG
GFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSA
YRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGC
YLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKYLLSEEEDHFSEEQY
LAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATT
KLEEMLGCKTPIGKPATAKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15228	1.000	1.000	0.000	680	1.000	1.000	O15228.pdb.gz	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
2	AFDB:P98192	0.961	0.964	6.818E-93	678	0.810	0.813	P98192.pdb.gz	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
3	AFDB:Q54I12	0.850	0.461	4.996E-44	1279	0.294	0.156	Q54I12.pdb.gz	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
4	AFDB:I7LW01	0.803	0.489	1.130E-38	1140	0.284	0.169	I7LW01.pdb.gz	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
5	AFDB:P97564	0.817	0.676	7.360E-35	828	0.222	0.182	P97564.pdb.gz	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
6	AFDB:Q22949	0.785	0.746	2.048E-33	718	0.234	0.221	Q22949.pdb.gz	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
7	AFDB:Q583Z3	0.716	0.403	5.939E-33	1242	0.235	0.129	Q583Z3.pdb.gz	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
8	AFDB:Q9Y137	0.803	0.649	2.071E-30	850	0.210	0.168	Q9Y137.pdb.gz	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
9	AFDB:P0A7A7	0.682	0.583	2.093E-27	807	0.200	0.169	P0A7A7.pdb.gz	PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsB PE=1 SV=2
10	AFDB:P9WI61	0.720	0.625	1.923E-26	789	0.178	0.153	P9WI61.pdb.gz	PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB PE=1 SV=1
11	PDB:7cteC	0.111	0.123	4.580E-3	592	0.118	0.135	7cteC.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
12	PDB:5f2tB	0.169	0.377	2.700E-2	262	0.057	0.149	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
13	PDB:7tjhC	0.088	0.108	5.489E-2	546	0.094	0.117	7tjhC.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
14	PDB:3m8eA	0.087	0.437	2.269E-1	101	0.019	0.129	3m8eA.pdb.gz
15	PDB:6h1cB	0.082	0.358	2.709E-1	134	0.022	0.112	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
16	PDB:2o2eB	0.105	0.184	2.832E-1	316	0.041	0.089	2o2eB.pdb.gz
17	PDB:3euhC	0.107	0.271	3.235E-1	206	0.050	0.165	3euhC.pdb.gz
18	PDB:5afqB	0.089	0.130	3.863E-1	444	0.040	0.061	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
19	PDB:4ad9A	0.111	0.230	4.613E-1	288	0.021	0.049	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
20	PDB:5dcaA	0.130	0.064	5.041E-1	1948	0.106	0.037	5dcaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G1SPE9	0.0	1273	679	0.903	0.904	G1SPE9_RABIT Dihydroxyacetone phosphate acyltransferase OS=Oryctolagus cuniculus OX=9986 GN=GNPAT PE=3 SV=2
2	O15228	0.0	1399	680	1.000	1.000	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
3	P98192	0.0	1140	678	0.797	0.799	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
4	Q9ES71	0.0	1138	678	0.801	0.804	GNPAT_RAT Dihydroxyacetone phosphate acyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpat PE=1 SV=1
5	I7LW01	1.16e-76	268	1140	0.300	0.179	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
6	Q54I12	3.21e-75	265	1279	0.182	0.097	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
7	Q4Q396	4.02e-56	209	1436	0.169	0.080	Q4Q396_LEIMA Dihydroxyacetonephosphate acyltransferase OS=Leishmania major OX=5664 GN=DAT PE=3 SV=1
8	Q583Z3	9.64e-52	196	1242	0.184	0.101	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
9	Q22949	5.59e-44	170	718	0.256	0.242	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
10	P0A7A7	2.10e-36	148	807	0.132	0.112	PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsB PE=1 SV=2
11	P97564	6.34e-35	144	828	0.193	0.158	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
12	G8JY39	4.56e-34	139	558	0.213	0.260	G8JY39_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=1 SV=1
13	Q61586	2.30e-33	139	827	0.185	0.152	GPAT1_MOUSE Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Gpam PE=1 SV=2
14	Q9Y137	1.31e-32	137	850	0.128	0.102	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
15	Q9HCL2	4.22e-31	132	828	0.121	0.099	GPAT1_HUMAN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GPAM PE=1 SV=3
16	P9WI61	1.03e-25	115	789	0.206	0.177	PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB PE=1 SV=1
17	P9WI59	1.32e-22	105	621	0.201	0.221	PLSB1_MYCTU Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB1 PE=1 SV=1
18	Q14DK4	1.06e-07	57.8	801	0.088	0.075	GPAT2_MOUSE Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Gpat2 PE=1 SV=3
19	Q6NUI2	5.79e-07	55.5	795	0.101	0.087	GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GPAT2 PE=2 SV=2
20	D3ZI76	2.14e-06	53.5	801	0.088	0.075	GPAT2_RAT Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpat2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	7.5e-22	88.8	Acyltransferase
2	PF19947 DUF6409	4.9e+02	12.1	Family of unknown function (DUF6409)
3	PF19277 GPAT_C	1.9e-29	114.3	Glycerol-3-phosphate acyltransferase C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264167	0.995	Alkyldihydroxyacetonephosphate synthase, peroxisomal
2	9606.ENSP00000217455	0.978	Acyl-coenzyme A thioesterase 8
3	9606.ENSP00000317721	0.977	Peroxisomal sarcosine oxidase
4	9606.ENSP00000231887	0.974	Peroxisomal bifunctional enzyme
5	9606.ENSP00000293217	0.974	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000307697	0.974	Peroxisomal acyl-coenzyme A oxidase 2
7	9606.ENSP00000369461	0.974	Enoyl-CoA delta isomerase 2, mitochondrial
8	9606.ENSP00000368066	0.971	Hydroxyacid oxidase 1
9	9606.ENSP00000420914	0.968	Peroxisomal multifunctional enzyme type 2
10	9606.ENSP00000285737	0.967	Lon protease homolog 2, peroxisomal
11	9606.ENSP00000483507	0.966	Hydroxyacid oxidase 2
12	9606.ENSP00000221418	0.965	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
13	9606.ENSP00000259407	0.964	Bile acid-CoA:amino acid N-acyltransferase
14	9606.ENSP00000371517	0.964	Alpha-methylacyl-CoA racemase
15	9606.ENSP00000265322	0.963	Peroxisomal trans-2-enoyl-CoA reductase
16	9606.ENSP00000348775	0.960	Peroxisomal acyl-coenzyme A oxidase 3
17	9606.ENSP00000323071	0.959	Acyl-coenzyme A thioesterase 4
18	9606.ENSP00000241052	0.957	Catalase
19	9606.ENSP00000302620	0.953	Alanine-glyoxylate aminotransferase
20	9606.ENSP00000301149	0.952	Glycerol-3-phosphate dehydrogenase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016287	1.000	glycerone-phosphate O-acyltransferase activity
GO:0005515	0.959	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044255	0.990	cellular lipid metabolic process
GO:0018904	0.974	ether metabolic process
GO:0097384	0.974	cellular lipid biosynthetic process
GO:1901503	0.943	ether biosynthetic process
GO:0044249	0.935	cellular biosynthetic process
GO:0019637	0.509	organophosphate metabolic process
GO:0006796	0.507	phosphate-containing compound metabolic process
GO:0046486	0.495	glycerolipid metabolic process
GO:0006644	0.368	phospholipid metabolic process
GO:0045017	0.359	glycerolipid biosynthetic process
GO:0006650	0.357	glycerophospholipid metabolic process
GO:0090407	0.301	organophosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	1.000	peroxisome
GO:0070013	0.997	intracellular organelle lumen
GO:0005829	0.991	cytosol
GO:0016020	0.982	membrane
GO:0005782	0.927	peroxisomal matrix
GO:0031090	0.883	organelle membrane
GO:0005778	0.767	peroxisomal membrane
GO:0005634	0.392	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17657	1.000	an acyl-CoA + dihydroxyacetone phosphate = a 1-acylglycerone 3-phosphate + CoA
EC:2.3.1.42	1.000	glycerone-phosphate O-acyltransferase.

[back to server]