StarFunc result for job id O15229

User Input

>input (486 residues)
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15229	1.000	1.000	4.075E-101	486	1.000	1.000	O15229.pdb.gz	KMO_HUMAN Kynurenine 3-monooxygenase OS=Homo sapiens OX=9606 GN=KMO PE=1 SV=2
2	AFDB:Q91WN4	0.902	0.915	1.959E-83	479	0.761	0.772	Q91WN4.pdb.gz	KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus OX=10090 GN=Kmo PE=1 SV=1
3	AFDB:Q1RLY6	0.918	0.941	4.460E-75	474	0.601	0.616	Q1RLY6.pdb.gz	KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 GN=kmo PE=2 SV=1
4	PDB:6lkeA	0.858	0.973	1.073E-71	428	0.728	0.827	6lkeA.pdb.gz	Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.
5	AFDB:Q86PM2	0.904	0.923	8.908E-63	476	0.440	0.450	Q86PM2.pdb.gz	KMO_AEDAE Kynurenine 3-monooxygenase OS=Aedes aegypti OX=7159 GN=kh PE=1 SV=2
6	AFDB:A1Z746	0.867	0.905	1.948E-58	465	0.418	0.437	A1Z746.pdb.gz	KMO_DROME Kynurenine 3-monooxygenase OS=Drosophila melanogaster OX=7227 GN=cn PE=2 SV=2
7	AFDB:Q5A7M3	0.869	0.925	4.107E-52	456	0.364	0.388	Q5A7M3.pdb.gz	KMO_CANAL Kynurenine 3-monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNA4 PE=3 SV=1
8	AFDB:P38169	0.871	0.918	4.527E-48	460	0.340	0.359	P38169.pdb.gz	KMO_YEAST Kynurenine 3-monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA4 PE=1 SV=1
9	AFDB:Q84HF5	0.824	0.867	2.562E-45	461	0.317	0.334	Q84HF5.pdb.gz	KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens OX=294 GN=kmo PE=1 SV=1
10	AFDB:C0LTL7	0.818	0.835	2.985E-44	476	0.317	0.324	C0LTL7.pdb.gz	C0LTL7_STRSJ SibC OS=Streptosporangium sibiricum OX=457432 GN=sibC PE=4 SV=1
11	PDB:5fn0A	0.806	0.859	4.994E-43	455	0.315	0.336	5fn0A.pdb.gz	Kynurenine-3-Monooxygenase Inhibition Prevents Multiple Organ Failure in Rodent Models of Acute Pancreatitis.
12	AFDB:Q38ER6	0.648	0.540	1.641E-24	595	0.191	0.156	Q38ER6.pdb.gz	Q38ER6_TRYB2 Flavoprotein monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4910 PE=4 SV=1
13	PDB:7on9A	0.604	0.734	1.145E-22	393	0.136	0.168	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
14	PDB:1d7lA	0.591	0.713	6.348E-22	394	0.132	0.162	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
15	PDB:3c96A	0.596	0.745	3.456E-20	381	0.144	0.184	3c96A.pdb.gz	Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa.
16	PDB:3rp6A	0.609	0.740	4.869E-20	392	0.140	0.173	3rp6A.pdb.gz	Structural and Mechanistic Studies of HpxO, a Novel Flavin Adenine Dinucleotide-Dependent Urate Oxidase from Klebsiella pneumoniae.
17	PDB:3ihgA	0.559	0.512	1.083E-19	535	0.158	0.144	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
18	PDB:2vouA	0.545	0.658	2.859E-19	393	0.123	0.153	2vouA.pdb.gz	Structure of 2,6-Dihydroxypyridine 3-Hydroxylase from a Nicotine-Degrading Pathway.
19	PDB:4k22A	0.552	0.731	1.192E-18	354	0.140	0.192	4k22A.pdb.gz
20	PDB:7lo1A	0.565	0.642	2.233E-18	422	0.158	0.182	7lo1A.pdb.gz	Deciphering the evolution of flavin-dependent monooxygenase stereoselectivity using ancestral sequence reconstruction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15229	0.0	1019	486	1.000	1.000	KMO_HUMAN Kynurenine 3-monooxygenase OS=Homo sapiens OX=9606 GN=KMO PE=1 SV=2
2	O88867	0.0	779	478	0.765	0.778	KMO_RAT Kynurenine 3-monooxygenase OS=Rattus norvegicus OX=10116 GN=Kmo PE=1 SV=1
3	Q1RLY6	0.0	643	474	0.591	0.605	KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 GN=kmo PE=2 SV=1
4	Q91WN4	0.0	806	479	0.784	0.795	KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus OX=10090 GN=Kmo PE=1 SV=1
5	Q86PM2	1.47e-146	429	476	0.424	0.433	KMO_AEDAE Kynurenine 3-monooxygenase OS=Aedes aegypti OX=7159 GN=kh PE=1 SV=2
6	A1Z746	9.66e-136	401	465	0.416	0.434	KMO_DROME Kynurenine 3-monooxygenase OS=Drosophila melanogaster OX=7227 GN=cn PE=2 SV=2
7	Q5A7M3	3.76e-97	302	456	0.352	0.375	KMO_CANAL Kynurenine 3-monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNA4 PE=3 SV=1
8	P38169	6.13e-92	289	460	0.346	0.365	KMO_YEAST Kynurenine 3-monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA4 PE=1 SV=1
9	Q84HF5	1.03e-86	275	461	0.313	0.330	KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens OX=294 GN=kmo PE=1 SV=1
10	C0LTL7	3.54e-71	235	476	0.294	0.300	C0LTL7_STRSJ SibC OS=Streptosporangium sibiricum OX=457432 GN=sibC PE=4 SV=1
11	O01884	2.16e-11	68.2	451	0.187	0.202	COQ6_CAEEL Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-6 PE=3 SV=2
12	P77397	1.37e-09	62.8	554	0.150	0.132	MHPA_ECOLI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=mhpA PE=1 SV=1
13	A6T923	5.29e-09	60.5	384	0.160	0.203	HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=hpxO PE=1 SV=1
14	Q6F6Y2	1.26e-07	56.2	385	0.156	0.197	HPXO_ACIAD FAD-dependent urate hydroxylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=hpxO PE=1 SV=1
15	Q9I0Q0	3.59e-06	51.6	382	0.123	0.157	PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pqsH PE=3 SV=1
16	Q5BEJ7	1.36e-05	49.7	440	0.103	0.114	AFOD_EMENI FAD-dependent monooxygenase afoD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoD PE=1 SV=1
17	Q38ER6	1.94e-05	49.7	595	0.086	0.071	Q38ER6_TRYB2 Flavoprotein monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4910 PE=4 SV=1
18	P75728	2.19e-05	48.9	391	0.163	0.202	UBIF_ECOLI 3-demethoxyubiquinol 3-hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=ubiF PE=1 SV=1
19	C8VQ98	2.91e-05	48.9	479	0.165	0.167	AUSM_EMENI FAD-dependent monooxygenase ausM OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ausM PE=3 SV=1
20	G8B709	6.15e-05	47.8	479	0.119	0.121	G8B709_CANPC FAD-binding domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=MNX1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02737 3HCDH_N	57	15.0	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
2	PF01266 DAO	0.0065	27.7	FAD dependent oxidoreductase
3	PF01494 FAD_binding_3	4.8e-21	87.0	FAD binding domain
4	PF13450 NAD_binding_8	0.031	25.8	NAD(P)-binding Rossmann-like domain
5	PF00070 Pyr_redox	1.2e+02	14.6	Pyridine nucleotide-disulphide oxidoreductase
6	PF07992 Pyr_redox_2	22	15.8	Pyridine nucleotide-disulphide oxidoreductase
7	PF08491 SE	2.8	18.5	Squalene epoxidase
8	PF04820 Trp_halogenase	65	13.8	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264170	0.999	Kynureninase
2	9606.ENSP00000423190	0.989	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
3	9606.ENSP00000328938	0.987	Kynurenine formamidase
4	9606.ENSP00000294973	0.986	3-hydroxyanthranilate 3,4-dioxygenase
5	9606.ENSP00000399415	0.986	Kynurenine--oxoglutarate transaminase 1
6	9606.ENSP00000260508	0.981	Kynurenine--oxoglutarate transaminase 3
7	9606.ENSP00000444788	0.945	Tryptophan 2,3-dioxygenase
8	9606.ENSP00000378782	0.858	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
9	9606.ENSP00000411788	0.850	G-protein coupled receptor 35
10	9606.ENSP00000348459	0.811	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
11	9606.ENSP00000355512	0.777	Opsin-3
12	9606.ENSP00000443432	0.736	Indoleamine 2,3-dioxygenase 2
13	9606.ENSP00000430950	0.715	Indoleamine 2,3-dioxygenase 1
14	9606.ENSP00000302620	0.697	Alanine-glyoxylate aminotransferase
15	9606.ENSP00000283871	0.686	Homogentisate 1,2-dioxygenase
16	9606.ENSP00000386942	0.672	Beta-galactoside alpha-2,6-sialyltransferase 2
17	9606.ENSP00000265605	0.661	Aldehyde dehydrogenase family 8 member A1
18	9606.ENSP00000169298	0.657	Beta-galactoside alpha-2,6-sialyltransferase 1
19	9606.ENSP00000291670	0.643	Formimidoyltransferase-cyclodeaminase
20	9606.ENSP00000447149	0.642	Bile acid receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004502	1.000	kynurenine 3-monooxygenase activity
GO:0071949	0.996	FAD binding
GO:0050664	0.941	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0005515	0.865	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042537	0.995	benzene-containing compound metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0034641	0.968	cellular nitrogen compound metabolic process
GO:0055086	0.962	nucleobase-containing small molecule metabolic process
GO:0072524	0.952	pyridine-containing compound metabolic process
GO:1901605	0.938	alpha-amino acid metabolic process
GO:0046496	0.935	nicotinamide nucleotide metabolic process
GO:0042180	0.928	cellular ketone metabolic process
GO:0019674	0.870	NAD metabolic process
GO:0046395	0.851	carboxylic acid catabolic process
GO:0009072	0.824	aromatic amino acid metabolic process
GO:0050896	0.817	response to stimulus
GO:0006568	0.799	tryptophan metabolic process
GO:1901606	0.781	alpha-amino acid catabolic process
GO:1901361	0.381	organic cyclic compound catabolic process
GO:0019439	0.379	aromatic compound catabolic process
GO:0009063	0.340	amino acid catabolic process
GO:0065007	0.313	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.990	cytosol
GO:0043226	0.970	organelle
GO:0043227	0.955	membrane-bounded organelle
GO:0016020	0.952	membrane
GO:0043231	0.913	intracellular membrane-bounded organelle
GO:0031090	0.871	organelle membrane
GO:0005739	0.749	mitochondrion
GO:0031967	0.607	organelle envelope
GO:0031966	0.592	mitochondrial membrane
GO:0005576	0.488	extracellular region
GO:0005615	0.467	extracellular space
GO:0070013	0.342	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20545	1.000	H(+) + L-kynurenine + NADPH + O2 = 3-hydroxy-L-kynurenine + H2O + NADP(+)
EC:1.14.13.9	1.000	kynurenine 3-monooxygenase.
EC:1.6.3.-	0.941	With oxygen as acceptor.

[back to server]