StarFunc result for job id O15230

User Input

>input (1400 residues)
MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCLCQPEFAGPHCDRCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDL
RGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS
CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANC
TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFV
EPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP
AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61292	0.250	0.198	1.867E-61	1799	0.211	0.165	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
2	AFDB:P15215	0.218	0.188	2.830E-61	1639	0.203	0.173	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
3	AFDB:A0A0R4IDN1	0.254	0.202	4.516E-61	1785	0.203	0.159	A0A0R4IDN1.pdb.gz
4	AFDB:Q1LVF0	0.226	0.201	1.935E-60	1593	0.196	0.172	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
5	AFDB:P11047	0.244	0.214	2.468E-59	1609	0.203	0.177	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
6	AFDB:B7ZDA6	0.257	0.204	3.739E-59	1782	0.199	0.156	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
7	AFDB:Q9Y6N6	0.250	0.224	3.739E-59	1575	0.221	0.197	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
8	AFDB:D3ZQN7	0.254	0.202	6.622E-59	1786	0.198	0.155	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
9	AFDB:Q9R0B6	0.257	0.229	1.301E-58	1581	0.211	0.187	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
10	AFDB:P11046	0.254	0.202	1.777E-58	1788	0.201	0.158	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
11	PDB:6vlsD	0.062	0.082	3.994E-6	963	0.022	0.032	6vlsD.pdb.gz
12	PDB:5eiyB	0.063	0.118	4.432E-6	658	0.034	0.071	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
13	PDB:4bxsV	0.073	0.079	2.106E-5	1262	0.024	0.026	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
14	PDB:6l4cB	0.048	0.135	2.877E-5	373	0.022	0.083	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
15	PDB:7kveB	0.072	0.074	5.095E-5	1374	0.022	0.023	7kveB.pdb.gz
16	PDB:4zelA	0.058	0.124	6.606E-5	550	0.043	0.109	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
17	PDB:2vqaA	0.052	0.140	1.001E-4	356	0.031	0.124	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
18	PDB:7l2zF	0.050	0.095	1.001E-4	664	0.031	0.066	7l2zF.pdb.gz
19	PDB:7ufgB	0.081	0.093	1.232E-4	1182	0.036	0.043	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:1fxzA	0.047	0.132	2.686E-4	371	0.027	0.102	1fxzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSA0	0.0	671	3277	0.278	0.119	A0A0A0MSA0_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
2	A0A1B0GWM3	0.0	665	3333	0.272	0.114	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
3	A0A8I6A4V6	0.0	2335	3699	0.815	0.308	A0A8I6A4V6_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=1
4	C1P640	0.0	897	3683	0.380	0.144	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
5	C1P641	0.0	904	3663	0.377	0.144	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	F1MAN8	0.0	2420	3713	0.834	0.314	F1MAN8_RAT Laminin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Lama5 PE=1 SV=2
7	G5EEV6	0.0	899	3704	0.379	0.143	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
8	O15230	0.0	2883	3695	1.000	0.379	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
9	Q00174	0.0	972	3712	0.377	0.142	LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster OX=7227 GN=LanA PE=1 SV=2
10	Q16787	0.0	672	3333	0.278	0.117	LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=3
11	Q21313	0.0	900	3672	0.379	0.144	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
12	Q2Q1W5	0.0	1789	3664	0.592	0.226	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
13	Q61001	0.0	2419	3718	0.839	0.316	LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus OX=10090 GN=Lama5 PE=1 SV=4
14	Q61789	0.0	664	3330	0.271	0.114	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4
15	P19137	5.69e-122	424	3083	0.168	0.076	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
16	P25391	4.77e-120	418	3075	0.168	0.076	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
17	F1MMT2	3.05e-119	414	1964	0.172	0.123	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
18	F1M614	4.65e-119	415	3117	0.169	0.076	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4
19	A0A0G2JWX2	4.88e-119	415	3121	0.169	0.076	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
20	A0A8I5ZPP7	6.15e-119	415	3137	0.169	0.076	A0A8I5ZPP7_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00053 Laminin_EGF	3.8e-81	278.4	Laminin EGF domain
2	PF00055 Laminin_N	1.2e-67	239.5	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252999

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258341	0.999	Laminin subunit gamma-1
2	9606.ENSP00000222399	0.996	Laminin subunit beta-1
3	9606.ENSP00000442600	0.993	Dystroglycan
4	9606.ENSP00000386896	0.987	Integrin alpha-6
5	9606.ENSP00000354360	0.985	Laminin subunit gamma-3
6	9606.ENSP00000388325	0.983	Laminin subunit beta-2
7	9606.ENSP00000007722	0.980	Integrin alpha-3
8	9606.ENSP00000200181	0.966	Integrin beta-4
9	9606.ENSP00000452120	0.964	Integrin alpha-7
10	9606.ENSP00000379350	0.963	Integrin beta-1
11	9606.ENSP00000375778	0.945	Laminin subunit beta-3
12	9606.ENSP00000282588	0.944	Integrin alpha-1
13	9606.ENSP00000346839	0.942	Fibronectin type III domain containing
14	9606.ENSP00000264144	0.939	Laminin subunit gamma-2
15	9606.ENSP00000368678	0.939	Agrin
16	9606.ENSP00000297268	0.931	Collagen alpha-2(I) chain
17	9606.ENSP00000374309	0.928	Laminin subunit alpha-1
18	9606.ENSP00000400365	0.925	Laminin subunit alpha-2
19	9606.ENSP00000383118	0.923	Cell division control protein 42 homolog
20	9606.ENSP00000308208	0.919	Matrix metalloproteinase-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.930	anatomical structure development
GO:0065007	0.805	biological regulation
GO:0050789	0.799	regulation of biological process
GO:0007275	0.799	multicellular organism development
GO:0050794	0.754	regulation of cellular process
GO:0030154	0.648	cell differentiation
GO:0009653	0.638	anatomical structure morphogenesis
GO:0007155	0.633	cell adhesion
GO:0048513	0.540	animal organ development
GO:0048731	0.486	system development
GO:0023052	0.421	signaling
GO:0050896	0.416	response to stimulus
GO:0031589	0.322	cell-substrate adhesion
GO:0071840	0.304	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0031012	0.995	extracellular matrix
GO:0062023	0.992	collagen-containing extracellular matrix
GO:0005604	0.918	basement membrane
GO:0005576	0.910	extracellular region
GO:0043256	0.890	laminin complex
GO:0043226	0.878	organelle
GO:0043227	0.855	membrane-bounded organelle
GO:0043229	0.581	intracellular organelle
GO:0043231	0.517	intracellular membrane-bounded organelle
GO:0005615	0.395	extracellular space
GO:0070062	0.302	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]