StarFunc result for job id O15243

User Input

>input (131 residues)
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD
ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF
GRGDDFSWEQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15243	1.000	1.000	2.636E-18	131	1.000	1.000	O15243.pdb.gz	OBRG_HUMAN Leptin receptor gene-related protein OS=Homo sapiens OX=9606 GN=LEPROT PE=1 SV=1
2	AFDB:O95214	0.947	0.947	7.816E-14	131	0.679	0.679	O95214.pdb.gz	LERL1_HUMAN Leptin receptor overlapping transcript-like 1 OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=2
3	AFDB:P47111	0.770	0.726	1.080E-4	140	0.267	0.250	P47111.pdb.gz	VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS55 PE=1 SV=1
4	AFDB:Q9UUH1	0.795	0.813	1.194E-4	128	0.214	0.219	Q9UUH1.pdb.gz	VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps55 PE=3 SV=2
5	AFDB:Q9AST6	0.706	0.664	4.408E-4	140	0.252	0.236	Q9AST6.pdb.gz	VSP55_ARATH Vacuolar protein sorting-associated protein 55 homolog OS=Arabidopsis thaliana OX=3702 GN=At1g32410 PE=2 SV=1
6	AFDB:F4J6B8	0.614	0.700	1.154E-2	113	0.176	0.204	F4J6B8.pdb.gz	F4J6B8_ARATH Vacuolar protein sorting 55 (VPS55) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g11530 PE=1 SV=1
7	AFDB:P56557	0.580	0.504	1.653E-1	158	0.130	0.108	P56557.pdb.gz	TM50B_HUMAN Transmembrane protein 50B OS=Homo sapiens OX=9606 GN=TMEM50B PE=1 SV=2
8	AFDB:Q5HYL7	0.340	0.274	7.096E-1	178	0.115	0.084	Q5HYL7.pdb.gz	TM196_HUMAN Transmembrane protein 196 OS=Homo sapiens OX=9606 GN=TMEM196 PE=1 SV=2
9	AFDB:P0ABC0	0.401	0.408	7.846E-1	126	0.107	0.111	P0ABC0.pdb.gz	ATPZ_ECOLI ATP synthase protein I OS=Escherichia coli (strain K12) OX=83333 GN=atpI PE=1 SV=2
10	PDB:7q83D	0.267	0.239	8.506E-1	156	0.099	0.083	7q83D.pdb.gz
11	PDB:1rhgB	0.319	0.297	8.944E-1	144	0.137	0.125	1rhgB.pdb.gz
12	PDB:7jpvE	0.413	0.393	9.405E-1	139	0.145	0.137	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
13	AFDB:Q5A477	0.324	0.138	1.061	371	0.168	0.059	Q5A477.pdb.gz	GMT_CANAL GDP-mannose transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VRG4 PE=3 SV=2
14	PDB:7nsuD	0.353	0.138	1.271	420	0.084	0.026	7nsuD.pdb.gz
15	PDB:6so5C	0.405	0.374	1.718	144	0.137	0.125	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
16	PDB:6kpcA	0.313	0.116	1.900	445	0.130	0.038	6kpcA.pdb.gz	Activation and Signaling Mechanism Revealed by Cannabinoid Receptor-GiComplex Structures.
17	PDB:7ocaG	0.246	0.218	1.900	158	0.176	0.146	7ocaG.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
18	PDB:7p34A	0.276	0.119	2.101	391	0.153	0.051	7p34A.pdb.gz	Molecular mechanism of SbmA, a promiscuous transporter exploited by antimicrobial peptides.
19	PDB:7c7sA	0.295	0.078	2.209	685	0.099	0.019	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
20	PDB:4g1uA	0.222	0.137	2.323	297	0.176	0.077	4g1uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15243	2.14e-91	262	131	1.000	1.000	OBRG_HUMAN Leptin receptor gene-related protein OS=Homo sapiens OX=9606 GN=LEPROT PE=1 SV=1
2	O89013	5.67e-87	251	131	0.947	0.947	OBRG_MOUSE Leptin receptor gene-related protein OS=Mus musculus OX=10090 GN=Leprot PE=1 SV=1
3	O95214	3.21e-62	188	131	0.679	0.679	LERL1_HUMAN Leptin receptor overlapping transcript-like 1 OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=2
4	Q6FHL7	3.21e-62	188	131	0.679	0.679	Q6FHL7_HUMAN LEPROTL1 protein OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=1
5	Q6PDU4	3.43e-62	188	131	0.679	0.679	LERL1_RAT Leptin receptor overlapping transcript-like 1 OS=Rattus norvegicus OX=10116 GN=Leprotl1 PE=1 SV=1
6	Q9UUH1	6.09e-09	52.8	128	0.244	0.250	VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps55 PE=3 SV=2
7	P47111	1.31e-07	49.3	140	0.298	0.279	VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS55 PE=1 SV=1
8	Q9AST6	1.08e-05	44.3	140	0.229	0.214	VSP55_ARATH Vacuolar protein sorting-associated protein 55 homolog OS=Arabidopsis thaliana OX=3702 GN=At1g32410 PE=2 SV=1
9	Q39191	0.73	31.6	735	0.115	0.020	WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabidopsis thaliana OX=3702 GN=WAK1 PE=1 SV=2
10	F4J6B8	0.75	30.8	113	0.183	0.212	F4J6B8_ARATH Vacuolar protein sorting 55 (VPS55) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g11530 PE=1 SV=1
11	P0A763	1.4	30.0	143	0.099	0.091	NDK_ECOLI Nucleoside diphosphate kinase OS=Escherichia coli (strain K12) OX=83333 GN=ndk PE=1 SV=2
12	P0DO30	3.8	29.6	4036	0.130	0.004	ILIA_NEOS2 Hybrid PKS-NRPS synthetase iliA OS=Neonectria sp. (strain DH2) OX=1735992 GN=iliA PE=1 SV=1
13	A0A0B4JCV6	3.9	29.6	2930	0.130	0.006	A0A0B4JCV6_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
14	A0A0B4JCW5	3.9	29.6	2929	0.130	0.006	A0A0B4JCW5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
15	A0A0B4JD62	3.9	29.6	2736	0.130	0.006	A0A0B4JD62_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
16	A0A0B4JDA1	3.9	29.6	3139	0.130	0.005	A0A0B4JDA1_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
17	A0A0B4JDB5	3.9	29.6	2737	0.130	0.006	A0A0B4JDB5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
18	A0A0B4LGQ5	3.9	29.6	2901	0.130	0.006	A0A0B4LGQ5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
19	A0A0B4LGR2	3.9	29.6	3111	0.130	0.005	A0A0B4LGR2_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
20	A0A0B4LHQ4	3.9	29.6	2708	0.130	0.006	A0A0B4LHQ4_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04133 Vps55	3.3e-32	122.3	Vacuolar protein sorting 55

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018429

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004705	0.796	Transmembrane protein 50B
2	61853.ENSNLEP00000024392	0.796	Transmembrane protein 50A
3	61853.ENSNLEP00000018469	0.609	Leptin receptor
4	61853.ENSNLEP00000015673	0.549	Glycoprotein hormones, alpha polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.984	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.991	positive regulation of cellular process
GO:0009966	0.938	regulation of signal transduction
GO:0048523	0.932	negative regulation of cellular process
GO:0032879	0.863	regulation of localization
GO:2000008	0.853	regulation of protein localization to cell surface
GO:1903747	0.853	regulation of establishment of protein localization to mitochondrion
GO:1904893	0.853	negative regulation of receptor signaling pathway via STAT
GO:1903533	0.851	regulation of protein targeting
GO:1903829	0.848	positive regulation of protein localization
GO:1903828	0.775	negative regulation of protein localization
GO:0032388	0.775	positive regulation of intracellular transport
GO:0051222	0.775	positive regulation of protein transport
GO:0046426	0.774	negative regulation of receptor signaling pathway via JAK-STAT
GO:0090316	0.774	positive regulation of intracellular protein transport
GO:0050896	0.387	response to stimulus
GO:0009987	0.368	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.997	Golgi apparatus
GO:0005768	0.980	endosome
GO:0016020	0.880	membrane
GO:0031090	0.307	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]