StarFunc result for job id O15244

User Input

>input (555 residues)
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15244	1.000	1.000	3.851E-77	555	1.000	1.000	O15244.pdb.gz	S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens OX=9606 GN=SLC22A2 PE=1 SV=2
2	AFDB:Q9R0W2	0.963	0.963	3.507E-64	555	0.820	0.820	Q9R0W2.pdb.gz	S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus OX=10116 GN=Slc22a2 PE=1 SV=1
3	AFDB:O77504	0.969	0.971	2.593E-59	554	0.685	0.686	O77504.pdb.gz	S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC22A1 PE=2 SV=1
4	AFDB:O15245	0.970	0.971	1.523E-58	554	0.695	0.697	O15245.pdb.gz	S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens OX=9606 GN=SLC22A1 PE=1 SV=2
5	AFDB:O08966	0.959	0.958	1.588E-58	556	0.690	0.689	O08966.pdb.gz	S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus OX=10090 GN=Slc22a1 PE=1 SV=2
6	AFDB:O75751	0.904	0.903	1.591E-47	556	0.490	0.489	O75751.pdb.gz	S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens OX=9606 GN=SLC22A3 PE=1 SV=1
7	AFDB:Q5VSI5	0.919	0.908	2.994E-47	562	0.495	0.489	Q5VSI5.pdb.gz
8	AFDB:O88446	0.903	0.910	8.857E-45	551	0.486	0.490	O88446.pdb.gz	S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus OX=10116 GN=Slc22a3 PE=1 SV=1
9	PDB:7zh0A	0.717	0.795	2.314E-36	495	0.470	0.527	7zh0A.pdb.gz
10	AFDB:Q9VCA2	0.866	0.876	7.187E-34	548	0.339	0.343	Q9VCA2.pdb.gz	ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster OX=7227 GN=Orct PE=1 SV=1
11	AFDB:Q95R48	0.863	0.846	3.879E-33	567	0.324	0.317	Q95R48.pdb.gz	OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster OX=7227 GN=Orct2 PE=2 SV=2
12	PDB:7aaqA	0.574	0.643	2.880E-11	487	0.168	0.191	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
13	PDB:6thaA	0.604	0.735	4.035E-11	448	0.153	0.190	6thaA.pdb.gz
14	PDB:7wsmA	0.652	0.772	6.149E-11	464	0.160	0.192	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
15	PDB:4gbyA	0.567	0.648	7.279E-11	475	0.182	0.213	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7sptA	0.557	0.641	1.691E-10	470	0.160	0.189	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
17	PDB:4ja4A	0.571	0.705	3.928E-10	442	0.162	0.204	4ja4A.pdb.gz
18	PDB:4ybqB	0.558	0.653	2.307E-9	462	0.146	0.175	4ybqB.pdb.gz
19	PDB:6s4mA	0.492	0.618	2.281E-7	426	0.124	0.162	6s4mA.pdb.gz
20	PDB:7bc7A	0.489	0.607	6.272E-7	432	0.124	0.160	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08966	0.0	806	556	0.690	0.689	S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus OX=10090 GN=Slc22a1 PE=1 SV=2
2	O15244	0.0	1142	555	1.000	1.000	S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens OX=9606 GN=SLC22A2 PE=1 SV=2
3	O15245	0.0	818	554	0.699	0.700	S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens OX=9606 GN=SLC22A1 PE=1 SV=2
4	O70577	0.0	936	553	0.832	0.835	S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus OX=10090 GN=Slc22a2 PE=1 SV=1
5	O75751	0.0	569	556	0.499	0.498	S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens OX=9606 GN=SLC22A3 PE=1 SV=1
6	O77504	0.0	810	554	0.683	0.684	S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC22A1 PE=2 SV=1
7	O88446	0.0	555	551	0.495	0.499	S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus OX=10116 GN=Slc22a3 PE=1 SV=1
8	Q63089	0.0	798	556	0.683	0.682	S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus OX=10116 GN=Slc22a1 PE=1 SV=1
9	Q7T2C0	0.0	584	562	0.495	0.489	Q7T2C0_DANRE Solute carrier family 22 member 2 OS=Danio rerio OX=7955 GN=zgc:64076 PE=2 SV=1
10	Q9R0W2	0.0	928	555	0.820	0.820	S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus OX=10116 GN=Slc22a2 PE=1 SV=1
11	Q9WTW5	0.0	549	551	0.492	0.495	S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus OX=10090 GN=Slc22a3 PE=1 SV=1
12	Q9VCA2	2.35e-97	308	548	0.350	0.354	ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster OX=7227 GN=Orct PE=1 SV=1
13	Q9WTN6	6.94e-88	284	564	0.337	0.332	S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus OX=10090 GN=Slc22a21 PE=2 SV=1
14	O76082	1.14e-83	273	557	0.333	0.332	S22A5_HUMAN Organic cation/carnitine transporter 2 OS=Homo sapiens OX=9606 GN=SLC22A5 PE=1 SV=1
15	Q95R48	4.09e-83	271	567	0.333	0.326	OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster OX=7227 GN=Orct2 PE=2 SV=2
16	A0A0E4G213	1.25e-81	267	546	0.323	0.328	A0A0E4G213_DANRE ETT ergothioneine transporter OS=Danio rerio OX=7955 GN=SLC22A4 PE=2 SV=1
17	Q8TCC7	1.72e-81	266	542	0.332	0.339	S22A8_HUMAN Organic anion transporter 3 OS=Homo sapiens OX=9606 GN=SLC22A8 PE=1 SV=1
18	Q9H015	2.58e-81	266	551	0.332	0.334	S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens OX=9606 GN=SLC22A4 PE=1 SV=3
19	Q2KJE9	4.52e-81	266	557	0.328	0.327	Q2KJE9_BOVIN Solute carrier family 22 (Organic cation/carnitine transporter), member 5 OS=Bos taurus OX=9913 GN=SLC22A5 PE=2 SV=1
20	O35956	1.35e-80	264	551	0.315	0.318	S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus OX=10116 GN=Slc22a6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	6.8e-22	89.5	Major Facilitator Superfamily
2	PF00083 Sugar_tr	3e-34	130.3	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326671	0.906	Multidrug and toxin extrusion protein 2
2	9606.ENSP00000270570	0.890	Multidrug and toxin extrusion protein 1
3	9606.ENSP00000349437	0.756	Cation-independent mannose-6-phosphate receptor
4	9606.ENSP00000363329	0.687	High affinity copper uptake protein 1
5	9606.ENSP00000261196	0.686	Solute carrier organic anion transporter family member 1B3
6	9606.ENSP00000441269	0.686	Solute carrier organic anion transporter family member
7	9606.ENSP00000256958	0.679	Solute carrier organic anion transporter family member 1B1
8	9606.ENSP00000362135	0.678	YrdC domain-containing protein, mitochondrial
9	9606.ENSP00000359478	0.656	Canalicular multispecific organic anion transporter 1
10	9606.ENSP00000364678	0.656	Histone-lysine N-methyltransferase EHMT2
11	9606.ENSP00000237612	0.643	ATP-binding cassette sub-family G member 2
12	9606.ENSP00000341963	0.643	Regulatory solute carrier protein family 1 member 1
13	9606.ENSP00000380081	0.635	Equilibrative nucleoside transporter 4
14	9606.ENSP00000360312	0.634	Barttin
15	9606.ENSP00000478255	0.633	Multidrug resistance protein 1
16	9606.ENSP00000255226	0.626	Urea transporter 2
17	9606.ENSP00000219833	0.621	Sodium-dependent noradrenaline transporter
18	9606.ENSP00000395723	0.610	Zinc finger protein 200
19	9606.ENSP00000289575	0.608	Solute carrier organic anion transporter family member 2B1
20	9606.ENSP00000377112	0.607	Solute carrier family 12 member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042910	0.999	xenobiotic transmembrane transporter activity
GO:0022804	0.998	active transmembrane transporter activity
GO:0019534	0.998	toxin transmembrane transporter activity
GO:1901505	0.996	carbohydrate derivative transmembrane transporter activity
GO:0015651	0.996	quaternary ammonium group transmembrane transporter activity
GO:0015932	0.995	nucleobase-containing compound transmembrane transporter activity
GO:0008504	0.992	monoamine transmembrane transporter activity
GO:0005337	0.992	nucleoside transmembrane transporter activity
GO:0005488	0.988	binding
GO:0008514	0.939	organic anion transmembrane transporter activity
GO:0005515	0.835	protein binding
GO:0005326	0.758	neurotransmitter transmembrane transporter activity
GO:0015291	0.696	secondary active transmembrane transporter activity
GO:0015318	0.615	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0042908	0.993	xenobiotic transport
GO:0009987	0.990	cellular process
GO:0071702	0.946	organic substance transport
GO:1901998	0.910	toxin transport
GO:0071705	0.873	nitrogen compound transport
GO:0015850	0.821	organic hydroxy compound transport
GO:0015695	0.695	organic cation transport
GO:0065007	0.689	biological regulation
GO:0015697	0.647	quaternary ammonium group transport
GO:0055085	0.561	transmembrane transport
GO:0015844	0.525	monoamine transport
GO:0015711	0.465	organic anion transport
GO:0051937	0.460	catecholamine transport
GO:0050896	0.344	response to stimulus
GO:0065008	0.343	regulation of biological quality
GO:0008152	0.341	metabolic process
GO:0015849	0.317	organic acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0098590	0.977	plasma membrane region
GO:0045177	0.960	apical part of cell
GO:0016324	0.949	apical plasma membrane
GO:0043227	0.935	membrane-bounded organelle
GO:0031982	0.769	vesicle
GO:0043231	0.728	intracellular membrane-bounded organelle
GO:0043230	0.628	extracellular organelle
GO:1903561	0.605	extracellular vesicle
GO:0070062	0.549	extracellular exosome
GO:0045178	0.507	basal part of cell
GO:0009925	0.477	basal plasma membrane
GO:0005737	0.454	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]