StarFunc result for job id O15266

User Input

>input (292 residues)
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R385	0.362	0.362	9.029E-39	292	1.000	1.000	A0A024R385.pdb.gz
2	AFDB:B0S5T0	0.497	0.508	5.073E-32	285	0.846	0.867	B0S5T0.pdb.gz	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
3	AFDB:Q3B7G6	0.286	0.320	1.572E-25	258	0.651	0.736	Q3B7G6.pdb.gz
4	AFDB:O60902	0.395	0.353	6.304E-25	331	0.627	0.553	O60902.pdb.gz	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
5	AFDB:Q7SZN8	0.445	0.436	1.221E-24	299	0.671	0.656	Q7SZN8.pdb.gz	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
6	AFDB:O42115	0.279	0.191	1.040E-10	453	0.339	0.219	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
7	AFDB:O42357	0.281	0.255	1.652E-10	327	0.267	0.239	O42357.pdb.gz	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
8	AFDB:O42356	0.258	0.230	8.078E-10	330	0.271	0.239	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
9	AFDB:A6YP92	0.272	0.149	1.371E-9	566	0.315	0.163	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
10	AFDB:Q6P295	0.271	0.321	2.178E-9	245	0.274	0.327	Q6P295.pdb.gz	Q6P295_DANRE Paired mesoderm homeobox protein 1 OS=Danio rerio OX=7955 GN=fa97b09 PE=2 SV=1
11	PDB:4egcA	0.174	0.094	8.268E-3	539	0.051	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.167	0.594	4.930E-2	73	0.062	0.247	2hi3A.pdb.gz
13	PDB:7fbyA	0.130	0.228	1.346	153	0.058	0.111	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.128	0.323	2.441	86	0.041	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:2cg4A	0.114	0.211	2.607	149	0.031	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:4l5jA	0.091	0.087	2.976	308	0.051	0.049	4l5jA.pdb.gz	Crystal Structures of the LsrR Proteins Complexed with Phospho-AI-2 and Two Signal-Interrupting Analogues Reveal Distinct Mechanisms for Ligand Recognition.
17	PDB:4ldzA	0.138	0.193	3.180	196	0.024	0.036	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
18	PDB:6xywBD	0.142	0.179	3.397	210	0.041	0.057	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:2vbwA	0.086	0.144	3.629	147	0.051	0.102	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
20	PDB:3f51A	0.129	0.375	3.877	94	0.027	0.085	3f51A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15266	0.0	605	292	1.000	1.000	SHOX_HUMAN Short stature homeobox protein OS=Homo sapiens OX=9606 GN=SHOX PE=1 SV=1
2	B0S5T0	9.77e-163	455	285	0.846	0.867	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
3	Q7SZN8	4.85e-108	317	299	0.661	0.645	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
4	P70390	1.37e-100	299	331	0.678	0.598	SHOX2_MOUSE Short stature homeobox protein 2 OS=Mus musculus OX=10090 GN=Shox2 PE=2 SV=1
5	O60902	2.24e-87	266	331	0.644	0.568	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
6	O42357	3.53e-26	107	327	0.250	0.223	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
7	O42358	1.23e-25	105	292	0.229	0.229	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
8	O35602	4.42e-25	104	342	0.277	0.237	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
9	Q9Y2V3	2.70e-24	102	346	0.274	0.231	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
10	O42115	4.08e-24	103	453	0.168	0.108	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
11	Q96QS3	4.29e-24	103	562	0.168	0.087	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
12	A6YP92	4.30e-24	103	566	0.168	0.087	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
13	O35085	5.97e-24	103	564	0.168	0.087	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
14	F1Q9S0	6.80e-24	102	469	0.205	0.128	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
15	A6NNA5	1.28e-23	99.0	263	0.151	0.167	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
16	Q06453	1.56e-23	101	408	0.216	0.154	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
17	Q8BYH0	1.63e-23	98.6	263	0.151	0.167	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
18	O42356	1.91e-23	99.8	330	0.240	0.212	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
19	Q6NYV4	2.18e-23	98.6	277	0.154	0.162	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
20	Q5I7G4	2.29e-23	98.6	284	0.154	0.158	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10152 CCDC53	1.1e+02	14.7	Subunit CCDC53 of WASH complex
2	PF05920 Homeobox_KN	0.64	21.3	Homeobox KN domain
3	PF00046 Homeodomain	3.5e-21	86.1	Homeodomain
4	PF12824 MRP-L20	23	16.6	Mitochondrial ribosomal protein subunit L20
5	PF03826 OAR	0.00022	32.1	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441417	0.817	Arylsulfatase E
2	9606.ENSP00000370588	0.732	CD99 antigen
3	9606.ENSP00000398273	0.697	Transcription factor SOX-5
4	9606.ENSP00000371073	0.666	PI-PLC X domain-containing protein 1
5	9606.ENSP00000316598	0.650	Putative GTP-binding protein 6
6	9606.ENSP00000370213	0.645	H(+)/Cl(-) exchange transporter 4
7	9606.ENSP00000217961	0.641	Steryl-sulfatase
8	9606.ENSP00000359567	0.615	Transcription factor SOX-3
9	9606.ENSP00000380053	0.604	PRD class homeoboxes and pseudogenes
10	9606.ENSP00000375080	0.595	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
11	9606.ENSP00000379369	0.591	Forkhead box B1
12	9606.ENSP00000379644	0.579	Transcription factor SOX-6
13	9606.ENSP00000370479	0.561	Variable charge X-linked protein 3
14	9606.ENSP00000367013	0.542	Tumor necrosis factor receptor superfamily member 25
15	9606.ENSP00000394227	0.536	Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
16	9606.ENSP00000245479	0.534	Transcription factor SOX-9
17	9606.ENSP00000334113	0.516	Dehydrogenase/reductase SDR family member on chromosome X
18	9606.ENSP00000370718	0.509	N-acetylserotonin O-methyltransferase-like protein
19	9606.ENSP00000370639	0.508	Acetylserotonin O-methyltransferase
20	9606.ENSP00000241256	0.506	Growth hormone secretagogue receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0005515	0.996	protein binding
GO:0003690	0.995	double-stranded DNA binding
GO:1990837	0.993	sequence-specific double-stranded DNA binding
GO:0000981	0.983	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.891	DNA-binding transcription activator activity
GO:0001228	0.858	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000976	0.806	transcription cis-regulatory region binding
GO:0000977	0.735	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0032501	0.989	multicellular organismal process
GO:0048856	0.987	anatomical structure development
GO:0050794	0.982	regulation of cellular process
GO:0019222	0.962	regulation of metabolic process
GO:0007275	0.956	multicellular organism development
GO:0048731	0.921	system development
GO:0009889	0.898	regulation of biosynthetic process
GO:0010468	0.896	regulation of gene expression
GO:0001501	0.875	skeletal system development
GO:0009987	0.841	cellular process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0080090	0.839	regulation of primary metabolic process
GO:0051171	0.835	regulation of nitrogen compound metabolic process
GO:0048518	0.803	positive regulation of biological process
GO:0010556	0.666	regulation of macromolecule biosynthetic process
GO:0031326	0.666	regulation of cellular biosynthetic process
GO:0051252	0.616	regulation of RNA metabolic process
GO:0009893	0.615	positive regulation of metabolic process
GO:0006355	0.607	regulation of DNA-templated transcription
GO:0048522	0.581	positive regulation of cellular process
GO:0048513	0.537	animal organ development
GO:0051173	0.447	positive regulation of nitrogen compound metabolic process
GO:0031325	0.350	positive regulation of cellular metabolic process
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0048519	0.306	negative regulation of biological process
GO:0010557	0.301	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.684	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]