StarFunc result for job id O15270

User Input

>input (562 residues)
MRPEPGGCCCRRTVRANGCVANGEVRNGYVRSSAAAAAAAAAGQIHHVTQNGGLYKRPFN
EAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFEN
FYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLG
FARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFA
TNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQ
PRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVV
EYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQII
TSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIG
AFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYS
RHRLVPLLDRPFDETTYEETED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15270	1.000	1.000	0.000	562	1.000	1.000	O15270.pdb.gz	SPTC2_HUMAN Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1
2	AFDB:Q9NUV7	0.872	0.888	1.610E-83	552	0.681	0.694	Q9NUV7.pdb.gz	SPTC3_HUMAN Serine palmitoyltransferase 3 OS=Homo sapiens OX=9606 GN=SPTLC3 PE=1 SV=3
3	PDB:7cqiT	0.847	0.953	1.683E-80	498	0.884	0.998	7cqiT.pdb.gz	Structural insights into the assembly and substrate selectivity of human SPT-ORMDL3 complex.
4	AFDB:Q9U912	0.835	0.786	6.655E-70	597	0.495	0.466	Q9U912.pdb.gz	Q9U912_DROME Serine palmitoyl transferase LCB2 subunit OS=Drosophila melanogaster OX=7227 GN=lace PE=2 SV=1
5	AFDB:Q9LSZ9	0.822	0.943	1.387E-64	489	0.445	0.511	Q9LSZ9.pdb.gz	LCB2A_ARATH Long chain base biosynthesis protein 2a OS=Arabidopsis thaliana OX=3702 GN=LCB2a PE=1 SV=1
6	AFDB:Q09925	0.838	0.782	3.499E-64	603	0.431	0.401	Q09925.pdb.gz	LCB2_SCHPO Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcb2 PE=3 SV=1
7	AFDB:P40970	0.819	0.820	4.875E-61	561	0.409	0.410	P40970.pdb.gz	LCB2_YEAST Serine palmitoyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB2 PE=1 SV=1
8	AFDB:Q38BJ5	0.826	0.833	1.771E-59	557	0.399	0.402	Q38BJ5.pdb.gz	Q38BJ5_TRYB2 Serine palmitoyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3220 PE=3 SV=1
9	AFDB:Q57YK7	0.645	0.888	6.418E-38	404	0.217	0.302	Q57YK7.pdb.gz	Q57YK7_TRYB2 2-amino-3-ketobutyrate coenzyme A ligase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.760 PE=3 SV=1
10	AFDB:O35704	0.634	0.750	3.868E-37	473	0.198	0.235	O35704.pdb.gz	SPTC1_MOUSE Serine palmitoyltransferase 1 OS=Mus musculus OX=10090 GN=Sptlc1 PE=1 SV=2
11	AFDB:P0AB77	0.650	0.909	4.809E-37	398	0.244	0.344	P0AB77.pdb.gz	KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) OX=83333 GN=kbl PE=1 SV=1
12	PDB:1fc4A	0.657	0.913	9.983E-36	401	0.242	0.339	1fc4A.pdb.gz	Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism.
13	PDB:7poaA	0.640	0.895	1.311E-35	398	0.253	0.357	7poaA.pdb.gz	An Irreversible, Promiscuous and Highly Thermostable Claisen-Condensation Biocatalyst Drives the Synthesis of Substituted Pyrroles
14	PDB:7k0mA	0.635	0.765	1.221E-34	464	0.210	0.254	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
15	PDB:5txrA	0.618	0.721	6.386E-32	479	0.199	0.234	5txrA.pdb.gz	Structure of the Mitochondrial Aminolevulinic Acid Synthase, a Key Heme Biosynthetic Enzyme.
16	PDB:1dj9A	0.616	0.891	8.112E-30	383	0.180	0.264	1dj9A.pdb.gz	Mechanism of 8-amino-7-oxononanoate synthase: spectroscopic, kinetic, and crystallographic studies.
17	PDB:5x6bJ	0.476	0.685	1.813E-15	377	0.110	0.164	5x6bJ.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
18	PDB:5ft8A	0.460	0.622	7.068E-15	401	0.091	0.127	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
19	PDB:3f9tA	0.489	0.673	1.218E-14	394	0.114	0.162	3f9tA.pdb.gz	Crystal structure of L-tyrosine decarboxylase MfnA (EC 4.1.1.25) (NP_247014.1) from METHANOCOCCUS JANNASCHII at 2.11 A resolution
20	PDB:2hufA	0.467	0.655	1.883E-14	385	0.100	0.145	2hufA.pdb.gz	Crystal Structures of Aedes aegypti Alanine Glyoxylate Aminotransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15270	0.0	1168	562	1.000	1.000	SPTC2_HUMAN Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1
2	P97363	0.0	1130	560	0.961	0.964	SPTC2_MOUSE Serine palmitoyltransferase 2 OS=Mus musculus OX=10090 GN=Sptlc2 PE=1 SV=2
3	Q9NUV7	0.0	804	552	0.681	0.694	SPTC3_HUMAN Serine palmitoyltransferase 3 OS=Homo sapiens OX=9606 GN=SPTLC3 PE=1 SV=3
4	Q9U912	0.0	587	597	0.489	0.461	Q9U912_DROME Serine palmitoyl transferase LCB2 subunit OS=Drosophila melanogaster OX=7227 GN=lace PE=2 SV=1
5	Q9V3F2	0.0	587	597	0.489	0.461	Q9V3F2_DROME LD36009p OS=Drosophila melanogaster OX=7227 GN=lace PE=1 SV=1
6	Q9LSZ9	3.17e-173	501	489	0.441	0.507	LCB2A_ARATH Long chain base biosynthesis protein 2a OS=Arabidopsis thaliana OX=3702 GN=LCB2a PE=1 SV=1
7	Q9M304	1.89e-172	499	489	0.438	0.503	LCB2B_ARATH Long chain base biosynthesis protein 2b OS=Arabidopsis thaliana OX=3702 GN=LCB2b PE=1 SV=1
8	P40970	2.91e-165	483	561	0.422	0.422	LCB2_YEAST Serine palmitoyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB2 PE=1 SV=1
9	Q09925	4.94e-161	474	603	0.423	0.395	LCB2_SCHPO Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcb2 PE=3 SV=1
10	Q38BJ5	9.62e-145	431	557	0.407	0.411	Q38BJ5_TRYB2 Serine palmitoyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3220 PE=3 SV=1
11	Q5SHZ8	2.08e-66	223	395	0.244	0.347	BIKB_THET8 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1582 PE=1 SV=1
12	A7LXM2	1.89e-60	207	394	0.222	0.317	SPT_BACO1 Serine palmitoyltransferase OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=spt PE=3 SV=1
13	Q8A9E5	6.54e-58	200	394	0.222	0.317	SPT_BACTN Serine palmitoyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=spt PE=1 SV=1
14	P0AB77	1.55e-57	199	398	0.230	0.324	KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) OX=83333 GN=kbl PE=1 SV=1
15	O88986	2.19e-55	194	416	0.228	0.308	KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus OX=10090 GN=Gcat PE=1 SV=2
16	O75600	1.61e-54	192	419	0.226	0.303	KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens OX=9606 GN=GCAT PE=1 SV=1
17	Q57YK7	4.84e-50	179	404	0.224	0.312	Q57YK7_TRYB2 2-amino-3-ketobutyrate coenzyme A ligase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.760 PE=3 SV=1
18	Q5W264	4.87e-50	184	653	0.212	0.182	PIGH_SERS3 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigH PE=1 SV=1
19	O59682	3.09e-48	177	509	0.203	0.224	LCB1_SCHPO Serine palmitoyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcb1 PE=3 SV=1
20	Q6NR46	1.90e-47	174	468	0.190	0.229	Q6NR46_DROME RE58623p OS=Drosophila melanogaster OX=7227 GN=Spt-I PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	4.7e-55	198.9	Aminotransferase class I and II
2	PF00266 Aminotran_5	39	14.7	Aminotransferase class-V
3	PF01212 Beta_elim_lyase	56	14.5	Beta-eliminating lyase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298130	0.995	Serine palmitoyltransferase small subunit A
2	9606.ENSP00000352097	0.994	Serine palmitoyltransferase small subunit B
3	9606.ENSP00000262554	0.993	Serine palmitoyltransferase 1
4	9606.ENSP00000385083	0.979	3-ketodihydrosphingosine reductase
5	9606.ENSP00000377724	0.969	ORM1-like protein 3
6	9606.ENSP00000349689	0.909	Palmitoyltransferase ZDHHC9
7	9606.ENSP00000381968	0.903	Serine palmitoyltransferase 3
8	9606.ENSP00000350378	0.902	Golgin subfamily A member 7
9	9606.ENSP00000326869	0.876	ORM1-like protein 1
10	9606.ENSP00000243045	0.850	ORM1-like protein 2
11	9606.ENSP00000333667	0.843	Serine hydroxymethyltransferase, mitochondrial
12	9606.ENSP00000318868	0.841	Serine hydroxymethyltransferase, cytosolic
13	9606.ENSP00000257549	0.824	L-serine dehydratase/L-threonine deaminase
14	9606.ENSP00000381231	0.823	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
15	9606.ENSP00000302620	0.820	Alanine-glyoxylate aminotransferase
16	9606.ENSP00000385790	0.819	Serine dehydratase-like
17	9606.ENSP00000339435	0.815	Serine racemase
18	9606.ENSP00000378854	0.810	Phosphoserine phosphatase
19	9606.ENSP00000373713	0.770	Phosphatidylinositide phosphatase SAC1
20	9606.ENSP00000362298	0.755	Sphingosine-1-phosphate lyase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004758	0.999	serine C-palmitoyltransferase activity
GO:0005488	0.982	binding
GO:0005515	0.932	protein binding
GO:0043167	0.548	ion binding
GO:0097159	0.416	organic cyclic compound binding
GO:1901363	0.409	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044249	0.997	cellular biosynthetic process
GO:0046519	0.997	sphingoid metabolic process
GO:0034312	0.997	diol biosynthetic process
GO:0030148	0.994	sphingolipid biosynthetic process
GO:0044271	0.988	cellular nitrogen compound biosynthetic process
GO:0006672	0.950	ceramide metabolic process
GO:0046513	0.909	ceramide biosynthetic process
GO:0065007	0.589	biological regulation
GO:0050789	0.563	regulation of biological process
GO:0050794	0.539	regulation of cellular process
GO:0046512	0.310	sphingosine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031090	0.995	organelle membrane
GO:0005783	0.972	endoplasmic reticulum
GO:0032991	0.958	protein-containing complex
GO:0005789	0.949	endoplasmic reticulum membrane
GO:1902494	0.736	catalytic complex
GO:1990234	0.699	transferase complex
GO:0005739	0.652	mitochondrion
GO:0140534	0.500	endoplasmic reticulum protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14761	0.999	H(+) + hexadecanoyl-CoA + L-serine = 3-oxosphinganine + CO2 + CoA
EC:2.3.1.50	0.999	serine C-palmitoyltransferase.

[back to server]