StarFunc result for job id O15294

User Input

>input (1046 residues)
MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMN
TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLY
LQMWEHYAAGNKPDHMIKPVEVTESA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ntfA	0.835	0.947	0.000	918	0.876	0.998	7ntfA.pdb.gz
2	AFDB:A0A2R8PZ91	0.976	0.913	0.000	1119	0.928	0.868	A0A2R8PZ91.pdb.gz
3	AFDB:O18158	0.947	0.862	0.000	1151	0.668	0.607	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
4	AFDB:Q7KJA9	0.939	0.927	0.000	1059	0.756	0.747	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
5	AFDB:Q9M8Y0	0.735	0.782	8.827E-77	977	0.394	0.422	Q9M8Y0.pdb.gz	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
6	AFDB:Q96301	0.399	0.448	2.884E-45	914	0.236	0.270	Q96301.pdb.gz	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
7	AFDB:Q3UV71	0.318	0.349	2.506E-21	942	0.119	0.132	Q3UV71.pdb.gz	TMTC1_MOUSE Protein O-mannosyl-transferase TMTC1 OS=Mus musculus OX=10090 GN=Tmtc1 PE=2 SV=2
8	AFDB:Q8IUR5	0.318	0.371	7.363E-21	882	0.118	0.139	Q8IUR5.pdb.gz	TMTC1_HUMAN Protein O-mannosyl-transferase TMTC1 OS=Homo sapiens OX=9606 GN=TMTC1 PE=1 SV=3
9	AFDB:Q57WP4	0.309	0.446	1.287E-20	673	0.098	0.152	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
10	AFDB:B5X0I6	0.315	0.304	1.656E-19	1091	0.103	0.099	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
11	AFDB:F4I3Z5	0.272	0.251	6.183E-19	1168	0.105	0.094	F4I3Z5.pdb.gz	SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana OX=3702 GN=SKI3 PE=1 SV=1
12	PDB:7qdrB	0.334	0.293	1.311E-15	1212	0.086	0.074	7qdrB.pdb.gz
13	PDB:7qe7J	0.225	0.430	6.469E-15	510	0.073	0.149	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:4bujB	0.309	0.248	1.004E-14	1367	0.075	0.057	4bujB.pdb.gz
15	PDB:6bq1B	0.265	0.345	2.513E-14	728	0.090	0.129	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:7dkhI	0.268	0.299	3.459E-14	914	0.093	0.106	7dkhI.pdb.gz
17	PDB:5dseA	0.278	0.468	3.899E-14	537	0.090	0.175	5dseA.pdb.gz
18	PDB:7qe7K	0.231	0.423	4.057E-14	531	0.075	0.147	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:8a3tJ	0.244	0.465	1.849E-13	509	0.072	0.147	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:6tedQ	0.189	0.216	4.819E-13	890	0.104	0.122	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVJ0	0.0	1976	1102	0.895	0.849	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
2	O15294	0.0	2189	1046	1.000	1.000	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
3	O18158	0.0	1438	1151	0.666	0.606	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
4	P56558	0.0	2149	1036	0.985	0.994	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
5	P81436	0.0	2187	1046	0.999	0.999	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
6	Q2L6Y4	0.0	1400	973	0.645	0.694	Q2L6Y4_CAEEL protein O-GlcNAc transferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=1
7	Q5GA10	0.0	2028	1036	0.923	0.931	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
8	Q5GA11	0.0	2055	1046	0.931	0.931	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
9	Q5GA12	0.0	2019	1052	0.923	0.917	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
10	Q5GA13	0.0	2045	1062	0.931	0.917	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
11	Q7KJA9	0.0	1657	1059	0.752	0.743	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
12	Q8CGY8	0.0	2181	1046	0.996	0.996	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
13	Q9M8Y0	0.0	598	977	0.293	0.314	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
14	Q9Y148	0.0	1594	1011	0.726	0.751	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
15	Q95RP9	7.36e-139	422	333	0.189	0.595	Q95RP9_DROME LD16758p OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
16	Q96301	1.45e-60	226	914	0.162	0.185	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
17	Q8IUR5	2.96e-30	131	882	0.107	0.127	TMTC1_HUMAN Protein O-mannosyl-transferase TMTC1 OS=Homo sapiens OX=9606 GN=TMTC1 PE=1 SV=3
18	Q3UV71	4.31e-30	131	942	0.107	0.119	TMTC1_MOUSE Protein O-mannosyl-transferase TMTC1 OS=Mus musculus OX=10090 GN=Tmtc1 PE=2 SV=2
19	Q5T4D3	3.40e-23	108	741	0.067	0.094	TMTC4_HUMAN Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
20	Q8BRH0	4.13e-22	105	920	0.091	0.103	TMTC3_MOUSE Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.4e+02	14.1	Anaphase-promoting complex, cyclosome, subunit 3
2	PF03704 BTAD	2.4	20.0	Bacterial transcriptional activator domain
3	PF20225 DUF6584	8.5e+02	11.3	Family of unknown function (DUF6584)
4	PF10373 EST1_DNA_bind	6.7	17.7	Est1 DNA/RNA binding domain
5	PF02259 FAT	0.00017	32.5	FAT domain
6	PF13844 Glyco_transf_41	0	1018.9	Glycosyl transferase family 41
7	PF09613 HrpB1_HrpK	8.7e+02	11.0	Bacterial type III secretion protein (HrpB1_HrpK)
8	PF08311 Mad3_BUB1_I	7.3e+02	11.5	Mad3/BUB1 homology region 1
9	PF04212 MIT	0.0055	28.0	MIT (microtubule interacting and transport) domain
10	PF12569 NatA_aux_su	8.2e-11	53.2	N-terminal acetyltransferase A, auxiliary subunit
11	PF18768 RNPP_C	26	15.7	RNPP family C-terminal domain
12	PF10602 RPN7	70	14.6	26S proteasome subunit RPN7
13	PF10516 SHNi-TPR	5.1	17.9	SHNi-TPR
14	PF14938 SNAP	2.3	19.2	Soluble NSF attachment protein, SNAP
15	PF04910 Tcf25	2.6e+02	12.1	Transcriptional repressor TCF25
16	PF06552 TOM20_plant	1.8e+02	13.3	Plant specific mitochondrial import receptor subunit TOM20
17	PF20308 TPR-S	1.2e-11	56.4	Tetratricopeptide Repeats-Sensor
18	PF00515 TPR_1	8.1e-94	315.2	Tetratricopeptide repeat
19	PF13374 TPR_10	1.4e-31	118.7	Tetratricopeptide repeat
20	PF13414 TPR_11	1.3e-86	295.3	TPR repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309555	0.999	Host cell factor 1
2	9606.ENSP00000354850	0.998	Protein O-GlcNAcase
3	9606.ENSP00000362748	0.995	Methylcytosine dioxygenase TET1
4	9606.ENSP00000442788	0.995	Methylcytosine dioxygenase TET2
5	9606.ENSP00000264867	0.988	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
6	9606.ENSP00000328998	0.977	Trafficking kinesin-binding protein 1
7	9606.ENSP00000373206	0.968	EGF domain-specific O-linked N-acetylglucosamine transferase
8	9606.ENSP00000386869	0.950	Methylcytosine dioxygenase TET3
9	9606.ENSP00000217244	0.947	Casein kinase II subunit alpha
10	9606.ENSP00000417132	0.938	Ubiquitin carboxyl-terminal hydrolase BAP1
11	9606.ENSP00000378402	0.937	Paired amphipathic helix protein Sin3a
12	9606.ENSP00000396749	0.936	KAT8 regulatory NSL complex subunit 3
13	9606.ENSP00000351446	0.935	WD repeat-containing protein 5
14	9606.ENSP00000383920	0.911	Putative Polycomb group protein ASXL2
15	9606.ENSP00000216274	0.910	Receptor-interacting serine/threonine-protein kinase 3
16	9606.ENSP00000259808	0.906	Receptor-interacting serine/threonine-protein kinase 1
17	9606.ENSP00000357622	0.903	CREB-regulated transcription coactivator 2
18	9606.ENSP00000415436	0.903	KAT8 regulatory NSL complex subunit 2
19	9606.ENSP00000349640	0.884	Microspherule protein 1
20	9606.ENSP00000363124	0.883	PHD finger protein 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005515	0.990	protein binding
GO:0016262	0.988	protein N-acetylglucosaminyltransferase activity
GO:0097363	0.481	protein O-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006493	0.995	protein O-linked glycosylation
GO:0050789	0.616	regulation of biological process
GO:0019222	0.444	regulation of metabolic process
GO:0050794	0.378	regulation of cellular process
GO:0080090	0.366	regulation of primary metabolic process
GO:0051171	0.365	regulation of nitrogen compound metabolic process
GO:0060255	0.339	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:1990234	0.992	transferase complex
GO:0140535	0.974	intracellular protein-containing complex
GO:0005829	0.974	cytosol
GO:0005654	0.961	nucleoplasm
GO:0043232	0.949	intracellular non-membrane-bounded organelle
GO:0030054	0.447	cell junction
GO:0005694	0.437	chromosome
GO:0045202	0.388	synapse
GO:0016020	0.318	membrane
GO:0098978	0.313	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:16533	0.988	L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-(N-acetyl-beta-D-glucosaminyl)-L-asparaginyl-[protein] + UDP
EC:2.4.1.94	0.988	protein N-acetylglucosaminyltransferase.
EC:2.4.1.255	0.481	protein O-GlcNAc transferase.

[back to server]