StarFunc result for job id O15296

User Input

>input (676 residues)
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4nreA	0.991	0.993	0.000	675	0.997	0.999	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.
2	AFDB:O15296	1.000	1.000	0.000	676	1.000	1.000	O15296.pdb.gz	LX15B_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=3
3	AFDB:Q8K4F2	0.996	0.994	1.129E-101	677	0.808	0.806	Q8K4F2.pdb.gz	LX15B_RAT Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Rattus norvegicus OX=10116 GN=Alox15b PE=1 SV=1
4	AFDB:O35936	0.992	0.991	2.625E-100	677	0.783	0.781	O35936.pdb.gz	ALOX8_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX8 OS=Mus musculus OX=10090 GN=Alox8 PE=1 SV=1
5	AFDB:D3ZKX9	0.978	0.930	2.948E-80	711	0.533	0.506	D3ZKX9.pdb.gz	LOXE3_RAT Hydroperoxide isomerase ALOXE3 OS=Rattus norvegicus OX=10116 GN=Aloxe3 PE=1 SV=1
6	AFDB:Q9BYJ1	0.976	0.929	2.948E-80	711	0.549	0.522	Q9BYJ1.pdb.gz	LOXE3_HUMAN Hydroperoxide isomerase ALOXE3 OS=Homo sapiens OX=9606 GN=ALOXE3 PE=1 SV=1
7	AFDB:O70582	0.972	0.938	3.549E-78	701	0.501	0.484	O70582.pdb.gz	LX12B_MOUSE Arachidonate 12-lipoxygenase, 12R-type OS=Mus musculus OX=10090 GN=Alox12b PE=1 SV=1
8	AFDB:O75342	0.971	0.937	9.972E-78	701	0.506	0.488	O75342.pdb.gz	LX12B_HUMAN Arachidonate 12-lipoxygenase, 12R-type OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1
9	AFDB:Q7T2A9	0.961	0.969	5.620E-70	670	0.426	0.430	Q7T2A9.pdb.gz	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
10	AFDB:A0A2R8RVT0	0.962	0.965	9.874E-70	674	0.407	0.408	A0A2R8RVT0.pdb.gz
11	AFDB:P09917	0.959	0.962	2.300E-69	674	0.426	0.427	P09917.pdb.gz	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
12	PDB:6ncfB	0.949	0.949	3.117E-64	676	0.422	0.422	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
13	PDB:7ttjA	0.904	0.950	6.305E-64	643	0.416	0.437	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
14	PDB:3v99B	0.898	0.949	2.235E-61	639	0.417	0.441	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
15	PDB:7ttlC	0.880	0.963	1.332E-60	617	0.414	0.454	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
16	PDB:7ttjB	0.837	0.956	4.948E-58	590	0.399	0.458	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
17	PDB:2p0mA	0.910	0.929	2.025E-57	662	0.371	0.379	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
18	PDB:1ygeA	0.826	0.675	8.867E-36	839	0.256	0.206	1ygeA.pdb.gz	Crystal structure of soybean lipoxygenase L-1 at 1.4 A resolution.
19	PDB:2iukA	0.834	0.683	7.330E-34	835	0.284	0.230	2iukA.pdb.gz	Crystal Structures of Vegetative Soybean Lipoxygenase Vlx-B and Vlx-D, and Comparisons with Seed Isoforms Lox-1 and Lox-3.
20	PDB:5fnoA	0.658	0.771	6.908E-24	568	0.207	0.246	5fnoA.pdb.gz	Crystal Structure of Manganese Lipoxygenase of the Rice Blast Fungus Magnaporthe Oryzae

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8A697	0.0	571	674	0.407	0.408	B8A697_DANRE Arachidonate 5-lipoxygenase OS=Danio rerio OX=7955 GN=alox5 PE=3 SV=1
2	D3ZKX9	0.0	724	711	0.534	0.508	LOXE3_RAT Hydroperoxide isomerase ALOXE3 OS=Rattus norvegicus OX=10116 GN=Aloxe3 PE=1 SV=1
3	I3L1D5	0.0	1362	664	0.982	1.000	I3L1D5_HUMAN Arachidonate 15-lipoxygenase type B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=1
4	O15296	0.0	1396	676	1.000	1.000	LX15B_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Homo sapiens OX=9606 GN=ALOX15B PE=1 SV=3
5	O35936	0.0	1119	677	0.783	0.781	ALOX8_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX8 OS=Mus musculus OX=10090 GN=Alox8 PE=1 SV=1
6	O70582	0.0	710	701	0.503	0.485	LX12B_MOUSE Arachidonate 12-lipoxygenase, 12R-type OS=Mus musculus OX=10090 GN=Alox12b PE=1 SV=1
7	O75342	0.0	703	701	0.506	0.488	LX12B_HUMAN Arachidonate 12-lipoxygenase, 12R-type OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1
8	P09917	0.0	573	674	0.426	0.427	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
9	P12527	0.0	571	673	0.420	0.422	LOX5_RAT Polyunsaturated fatty acid 5-lipoxygenase OS=Rattus norvegicus OX=10116 GN=Alox5 PE=1 SV=3
10	P48999	0.0	579	674	0.425	0.426	LOX5_MOUSE Polyunsaturated fatty acid 5-lipoxygenase OS=Mus musculus OX=10090 GN=Alox5 PE=1 SV=3
11	Q2KMM4	0.0	708	701	0.506	0.488	LX12B_RAT Arachidonate 12-lipoxygenase, 12R-type OS=Rattus norvegicus OX=10116 GN=Alox12b PE=1 SV=1
12	Q7T2A9	0.0	553	670	0.430	0.434	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
13	Q8K4F2	0.0	1143	677	0.808	0.806	LX15B_RAT Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Rattus norvegicus OX=10116 GN=Alox15b PE=1 SV=1
14	Q9BYJ1	0.0	737	711	0.546	0.519	LOXE3_HUMAN Hydroperoxide isomerase ALOXE3 OS=Homo sapiens OX=9606 GN=ALOXE3 PE=1 SV=1
15	Q9WV07	0.0	729	711	0.541	0.515	LOXE3_MOUSE Hydroperoxide isomerase ALOXE3 OS=Mus musculus OX=10090 GN=Aloxe3 PE=1 SV=2
16	P39655	1.16e-162	484	663	0.391	0.398	LOX12_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Mus musculus OX=10090 GN=Alox12 PE=1 SV=4
17	F1LQ70	8.30e-162	482	663	0.391	0.398	LOX12_RAT Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Rattus norvegicus OX=10116 GN=Alox12 PE=1 SV=1
18	P27479	3.48e-160	478	663	0.395	0.403	LOX15_BOVIN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Bos taurus OX=9913 GN=ALOX15 PE=1 SV=3
19	P18054	1.35e-155	466	663	0.370	0.377	LOX12_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Homo sapiens OX=9606 GN=ALOX12 PE=1 SV=4
20	A0A3B3IRK2	6.17e-155	454	389	0.333	0.578	A0A3B3IRK2_HUMAN Arachidonate 12-lipoxygenase, 12R type (Fragment) OS=Homo sapiens OX=9606 GN=ALOX12B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00305 Lipoxygenase	3.3e-63	225.9	Lipoxygenase
2	PF01477 PLAT	7.5e-20	83.1	PLAT/LH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354612	0.940	Prostaglandin G/H synthase 1
2	9606.ENSP00000356438	0.939	Prostaglandin G/H synthase 2
3	9606.ENSP00000221307	0.923	Docosahexaenoic acid omega-hydroxylase CYP4F3
4	9606.ENSP00000477567	0.919	Cytochrome P450 4F8
5	9606.ENSP00000221700	0.918	Phylloquinone omega-hydroxylase CYP4F2
6	9606.ENSP00000360317	0.915	Cytochrome P450 2C8
7	9606.ENSP00000251535	0.912	Arachidonate 12-lipoxygenase, 12S-type
8	9606.ENSP00000458832	0.912	Arachidonate 15-lipoxygenase
9	9606.ENSP00000363512	0.911	Arachidonate 5-lipoxygenase
10	9606.ENSP00000360247	0.910	Cytochrome P450 2J2
11	9606.ENSP00000260682	0.908	Cytochrome P450 2C9
12	9606.ENSP00000315167	0.906	Arachidonate 12-lipoxygenase, 12R-type
13	9606.ENSP00000324648	0.906	Cytochrome P450 2B6
14	9606.ENSP00000360372	0.906	Cytochrome P450 2C19
15	9606.ENSP00000440689	0.906	Cytochrome P450 2E1
16	9606.ENSP00000302665	0.905	Insulin-like growth factor I
17	9606.ENSP00000311095	0.905	Cytochrome P450 4A11
18	9606.ENSP00000360958	0.905	Cytochrome P450 4A22
19	9606.ENSP00000279804	0.904	Cardiotrophin-1
20	9606.ENSP00000333212	0.903	Cytochrome P450 2U1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016702	1.000	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0005488	0.975	binding
GO:0005515	0.960	protein binding
GO:0016165	0.813	linoleate 13S-lipoxygenase activity
GO:0004052	0.354	arachidonate 12(S)-lipoxygenase activity
GO:0043167	0.332	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006631	0.995	fatty acid metabolic process
GO:0006690	0.990	icosanoid metabolic process
GO:0001676	0.990	long-chain fatty acid metabolic process
GO:0033559	0.984	unsaturated fatty acid metabolic process
GO:0019369	0.965	arachidonic acid metabolic process
GO:0006633	0.699	fatty acid biosynthetic process
GO:0065007	0.419	biological regulation
GO:0042759	0.397	long-chain fatty acid biosynthetic process
GO:0050789	0.355	regulation of biological process
GO:0019372	0.353	lipoxygenase pathway
GO:0050794	0.338	regulation of cellular process
GO:0050896	0.332	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005886	0.980	plasma membrane
GO:0043226	0.940	organelle
GO:0043227	0.851	membrane-bounded organelle
GO:0043229	0.845	intracellular organelle
GO:0043231	0.728	intracellular membrane-bounded organelle
GO:0005576	0.413	extracellular region
GO:0012505	0.312	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	1.000	With incorporation of two atoms of oxygen.
RHEA:22780	0.813	(9Z,12Z)-octadecadienoate + O2 = (13S)-hydroperoxy-(9Z,11E)-octadecadienoate
EC:1.13.11.12	0.813	linoleate 13S-lipoxygenase.
RHEA:10428	0.354	(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate
EC:1.13.11.31	0.354	arachidonate 12-lipoxygenase.

[back to server]