StarFunc result for job id O15297

User Input

>input (605 residues)
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPG
GEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHL
WGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSG
VNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT
LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQ
RMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAK
ALTLRIHDSLNNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEE
SNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRK
TVCVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4M2	0.623	0.623	3.438E-99	605	1.000	1.000	A0A0S2Z4M2.pdb.gz	A0A0S2Z4M2_HUMAN Protein phosphatase Mg2+/Mn2+ dependent 1D isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPM1D PE=2 SV=1
2	PDB:1a6qA	0.343	0.556	5.850E-19	363	0.137	0.229	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
3	PDB:4oicB	0.342	0.658	1.038E-17	305	0.114	0.226	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
4	PDB:4jndA	0.340	0.497	5.887E-16	408	0.099	0.147	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
5	PDB:5nzzD	0.337	0.521	5.303E-13	379	0.099	0.158	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
6	PDB:7kprA	0.285	0.417	6.047E-12	403	0.093	0.139	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
7	PDB:2pk0A	0.263	0.588	6.523E-11	247	0.088	0.215	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
8	PDB:5d2uA	0.273	0.643	7.286E-11	240	0.091	0.229	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
9	PDB:6jkvA	0.262	0.624	1.095E-9	230	0.076	0.200	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
10	PDB:3w40A	0.217	0.571	5.370E-7	199	0.068	0.206	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
11	PDB:6rreD	0.231	0.310	1.667E-2	427	0.056	0.080	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.
12	AFDB:F1QUB9	0.062	0.043	1.296E-1	1065	0.116	0.066	F1QUB9.pdb.gz
13	AFDB:Q9EPZ6	0.064	0.064	1.530E-1	613	0.139	0.137	Q9EPZ6.pdb.gz	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
14	AFDB:A4VT01	0.098	0.090	2.660E-1	698	0.086	0.074	A4VT01.pdb.gz
15	AFDB:R9QT79	0.049	0.031	2.971E-1	1132	0.104	0.056	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
16	AFDB:O55005	0.065	0.033	6.097E-1	1651	0.116	0.042	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
17	AFDB:Q93VA8	0.060	0.096	6.097E-1	350	0.048	0.083	Q93VA8.pdb.gz	Q93VA8_ARATH Alba DNA/RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=ALBA1 PE=1 SV=1
18	AFDB:O08774	0.055	0.035	7.198E-1	1387	0.126	0.055	O08774.pdb.gz	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
19	AFDB:Q57YF5	0.046	0.078	7.607E-1	328	0.063	0.116	Q57YF5.pdb.gz	Q57YF5_TRYB2 Nucleolar RNA-binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.330 PE=4 SV=1
20	AFDB:A0A0A1I9R6	0.069	0.041	1.060	1245	0.094	0.046	A0A0A1I9R6.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4M2	0.0	1256	605	1.000	1.000	A0A0S2Z4M2_HUMAN Protein phosphatase Mg2+/Mn2+ dependent 1D isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPM1D PE=2 SV=1
2	B1WCA0	0.0	1092	598	0.891	0.901	B1WCA0_RAT Protein phosphatase, Mg2+/Mn2+ dependent, 1D OS=Rattus norvegicus OX=10116 GN=Ppm1d PE=3 SV=1
3	O15297	0.0	1256	605	1.000	1.000	PPM1D_HUMAN Protein phosphatase 1D OS=Homo sapiens OX=9606 GN=PPM1D PE=1 SV=1
4	Q9QZ67	0.0	1083	598	0.869	0.880	PPM1D_MOUSE Protein phosphatase 1D OS=Mus musculus OX=10090 GN=Ppm1d PE=2 SV=2
5	P93006	2.90e-27	115	380	0.149	0.237	P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana OX=3702 GN=PP2C27 PE=2 SV=1
6	Q9SLA1	4.27e-24	107	392	0.145	0.224	P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana OX=3702 GN=At2g25620 PE=1 SV=1
7	Q3EAF9	1.51e-23	105	384	0.140	0.221	P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana OX=3702 GN=At3g62260 PE=2 SV=1
8	A0A0B4K7Q3	3.91e-21	97.1	332	0.131	0.238	A0A0B4K7Q3_DROME Alphabet, isoform F OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
9	Q94AT1	6.33e-21	97.8	420	0.134	0.193	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
10	Q9VAK1	1.03e-20	96.7	368	0.131	0.215	Q9VAK1_DROME Alphabet, isoform A OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
11	Q8IMK7	1.17e-20	96.3	371	0.131	0.213	Q8IMK7_DROME Alphabet, isoform B OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
12	Q961C5	1.46e-20	96.3	374	0.131	0.211	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
13	Q8LAY8	1.62e-20	95.5	354	0.134	0.229	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
14	O75688	1.64e-19	94.0	479	0.147	0.186	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
15	C9JIR6	1.86e-19	92.8	378	0.147	0.235	C9JIR6_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
16	Q4PSE8	2.57e-19	93.2	447	0.132	0.179	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
17	P36993	3.43e-19	92.0	390	0.139	0.215	PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1
18	P35813	3.94e-19	92.0	382	0.145	0.230	PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
19	P20650	6.29e-19	91.3	382	0.139	0.220	PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1
20	P49443	6.53e-19	91.3	382	0.139	0.220	PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	8.3e-87	302.6	Protein phosphatase 2C
2	PF13672 PP2C_2	24	16.0	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.978	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000360493	0.973	Runt-related transcription factor 2
3	9606.ENSP00000415151	0.905	Core-binding factor subunit beta
4	9606.ENSP00000372023	0.902	Serine/threonine-protein kinase Chk2
5	9606.ENSP00000269305	0.889	Cellular tumor antigen p53
6	9606.ENSP00000434024	0.834	Histone H2AX
7	9606.ENSP00000083182	0.830	Amyloid protein-binding protein 2
8	9606.ENSP00000278616	0.771	Serine-protein kinase ATM
9	9606.ENSP00000279387	0.750	Serine/threonine-protein phosphatase 4 catalytic subunit
10	9606.ENSP00000392147	0.678	Protein phosphatase 6 catalytic subunit
11	9606.ENSP00000401508	0.678	Nicotinate phosphoribosyltransferase
12	9606.ENSP00000388648	0.670	Serine/threonine-protein kinase Chk1
13	9606.ENSP00000387046	0.642	Protein phosphatase, Mg2+/Mn2+ dependent 1M
14	9606.ENSP00000385571	0.615	Homeodomain-interacting protein kinase 2
15	9606.ENSP00000356150	0.604	Protein Mdm4
16	9606.ENSP00000264108	0.599	Histone acetyltransferase type B catalytic subunit
17	9606.ENSP00000377036	0.580	Serine/threonine-protein phosphatase 2A activator
18	9606.ENSP00000260983	0.574	E3 ubiquitin-protein ligase HECW2
19	9606.ENSP00000360268	0.566	Delta-1-pyrroline-5-carboxylate synthase
20	9606.ENSP00000346255	0.555	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0019901	0.999	protein kinase binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0051019	0.992	mitogen-activated protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050896	0.995	response to stimulus
GO:0071704	0.991	organic substance metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0051716	0.985	cellular response to stimulus
GO:0044237	0.985	cellular metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0006807	0.979	nitrogen compound metabolic process
GO:0006950	0.974	response to stress
GO:0043170	0.967	macromolecule metabolic process
GO:0048519	0.932	negative regulation of biological process
GO:0007154	0.873	cell communication
GO:0080090	0.873	regulation of primary metabolic process
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0031323	0.855	regulation of cellular metabolic process
GO:0010605	0.845	negative regulation of macromolecule metabolic process
GO:0033554	0.754	cellular response to stress
GO:0043412	0.713	macromolecule modification
GO:0071840	0.710	cellular component organization or biogenesis
GO:0016043	0.693	cellular component organization
GO:0048523	0.689	negative regulation of cellular process
GO:0019219	0.685	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.670	organonitrogen compound metabolic process
GO:0048518	0.559	positive regulation of biological process
GO:0009893	0.545	positive regulation of metabolic process
GO:0019538	0.499	protein metabolic process
GO:0006325	0.495	chromatin organization
GO:0036211	0.492	protein modification process
GO:0009889	0.489	regulation of biosynthetic process
GO:0031326	0.481	regulation of cellular biosynthetic process
GO:0010556	0.479	regulation of macromolecule biosynthetic process
GO:0006355	0.451	regulation of DNA-templated transcription
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0048522	0.420	positive regulation of cellular process
GO:0040029	0.404	epigenetic regulation of gene expression
GO:0051173	0.400	positive regulation of nitrogen compound metabolic process
GO:0006796	0.399	phosphate-containing compound metabolic process
GO:0007165	0.395	signal transduction
GO:0006974	0.392	cellular response to DNA damage stimulus
GO:0035556	0.371	intracellular signal transduction
GO:0009605	0.358	response to external stimulus
GO:0010629	0.346	negative regulation of gene expression
GO:0051172	0.330	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005730	0.996	nucleolus
GO:0005829	0.993	cytosol
GO:0032991	0.452	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]