StarFunc result for job id O15304

User Input

>input (175 residues)
MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDE
GCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRA
VDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15304	1.000	1.000	5.317E-34	175	1.000	1.000	O15304.pdb.gz	SIVA_HUMAN Apoptosis regulatory protein Siva OS=Homo sapiens OX=9606 GN=SIVA1 PE=1 SV=2
2	AFDB:O54926	0.621	0.621	4.054E-23	175	0.709	0.709	O54926.pdb.gz	SIVA_MOUSE Apoptosis regulatory protein Siva OS=Mus musculus OX=10090 GN=Siva1 PE=1 SV=1
3	AFDB:O88842	0.253	0.068	1.144E-2	733	0.154	0.037	O88842.pdb.gz	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
4	AFDB:Q9LQV4	0.205	0.091	3.991E-2	429	0.131	0.054	Q9LQV4.pdb.gz	Q9LQV4_ARATH F10B6.17 OS=Arabidopsis thaliana OX=3702 GN=At1g14770 PE=1 SV=1
5	AFDB:Q13615	0.233	0.040	7.213E-2	1198	0.206	0.030	Q13615.pdb.gz	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
6	AFDB:Q6ZQM0	0.212	0.108	7.703E-2	377	0.143	0.066	Q6ZQM0.pdb.gz	RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus OX=10090 GN=Rffl PE=1 SV=1
7	AFDB:H7BYJ1	0.184	0.072	1.002E-1	507	0.109	0.037	H7BYJ1.pdb.gz	H7BYJ1_HUMAN Ring finger protein 34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
8	AFDB:Q86YI8	0.167	0.109	1.696E-1	300	0.103	0.060	Q86YI8.pdb.gz	PHF13_HUMAN PHD finger protein 13 OS=Homo sapiens OX=9606 GN=PHF13 PE=1 SV=2
9	AFDB:Q9UBW7	0.169	0.027	1.696E-1	1377	0.143	0.018	Q9UBW7.pdb.gz	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
10	AFDB:Q9NYA4	0.226	0.039	2.356E-1	1195	0.217	0.032	Q9NYA4.pdb.gz	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
11	PDB:1b8tA	0.182	0.170	9.381E-1	192	0.120	0.109	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
12	PDB:6ydhA	0.131	0.285	1.002	62	0.069	0.194	6ydhA.pdb.gz
13	PDB:7uhyC	0.103	0.039	1.487	578	0.086	0.026	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:3j7a3	0.180	0.321	2.516	95	0.051	0.095	3j7a3.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
15	PDB:7uhyD	0.146	0.092	2.870	288	0.080	0.049	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:7zsb4	0.160	0.097	3.065	306	0.063	0.036	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:4btsA9	0.108	0.177	3.273	93	0.046	0.086	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
18	PDB:5z8lA	0.198	0.175	3.496	204	0.057	0.049	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
19	PDB:6hhqb	0.173	0.301	3.987	97	0.051	0.093	6hhqb.pdb.gz	Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
20	PDB:7myjC	0.140	0.066	4.258	465	0.074	0.028	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15304	3.95e-126	353	175	1.000	1.000	SIVA_HUMAN Apoptosis regulatory protein Siva OS=Homo sapiens OX=9606 GN=SIVA1 PE=1 SV=2
2	B4DTY2	6.40e-111	314	157	0.891	0.994	B4DTY2_HUMAN Apoptosis regulatory protein Siva OS=Homo sapiens OX=9606 GN=SIVA1 PE=1 SV=1
3	G3V439	2.14e-110	313	169	0.891	0.923	G3V439_HUMAN SIVA1 apoptosis inducing factor (Fragment) OS=Homo sapiens OX=9606 GN=SIVA1 PE=1 SV=1
4	O54926	5.03e-83	244	175	0.709	0.709	SIVA_MOUSE Apoptosis regulatory protein Siva OS=Mus musculus OX=10090 GN=Siva1 PE=1 SV=1
5	H0YJN1	1.14e-58	179	90	0.514	1.000	H0YJN1_HUMAN SIVA1 apoptosis inducing factor OS=Homo sapiens OX=9606 GN=SIVA1 PE=1 SV=2
6	P11067	0.074	35.4	502	0.143	0.050	NIFB_AZOVI FeMo cofactor biosynthesis protein NifB OS=Azotobacter vinelandii OX=354 GN=nifB PE=3 SV=1
7	Q03897	0.12	35.0	1148	0.086	0.013	WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTC5 PE=1 SV=1
8	Q386S1	0.67	32.7	913	0.154	0.030	Q386S1_TRYB2 Phosphoglycerate kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.22.0003 PE=3 SV=1
9	A0AVN2	0.71	32.7	777	0.126	0.028	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
10	Q99728	1.1	32.0	777	0.126	0.028	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
11	A0A0B4KGE5	1.9	31.2	1207	0.109	0.016	A0A0B4KGE5_DROME Bonus, isoform C OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
12	A8WHL4	2.0	31.2	1125	0.109	0.017	A8WHL4_DROME Bonus, isoform B OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
13	Q9U3Y7	2.0	31.2	1133	0.109	0.017	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
14	Q9VDK5	2.0	31.2	1133	0.109	0.017	Q9VDK5_DROME Bonus, isoform A OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=2
15	A0A0B4KH12	2.3	31.2	1119	0.109	0.017	A0A0B4KH12_DROME Bonus, isoform D OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
16	A0A0B4KHG7	2.3	31.2	1122	0.109	0.017	A0A0B4KHG7_DROME Bonus, isoform F OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
17	A0A0B4KHT0	2.3	31.2	1125	0.109	0.017	A0A0B4KHT0_DROME Bonus, isoform E OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
18	Q9P7Z8	2.5	30.0	124	0.109	0.153	YOUD_SCHPO Uncharacterized protein C26H8.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC26H8.13c PE=4 SV=1
19	O17514	3.0	30.8	773	0.097	0.022	MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans OX=6239 GN=mes-2 PE=1 SV=2
20	Q96A37	3.0	30.4	237	0.109	0.080	RN166_HUMAN E3 ubiquitin-protein ligase RNF166 OS=Homo sapiens OX=9606 GN=RNF166 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05458 Siva	4.1e-90	311.6	Cd27 binding protein (Siva)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.996	Bcl-2-like protein 1
2	9606.ENSP00000266557	0.979	CD27 antigen
3	9606.ENSP00000443256	0.948	Lysophosphatidic acid receptor 2
4	9606.ENSP00000360242	0.894	E3 ubiquitin-protein ligase XIAP
5	9606.ENSP00000381185	0.854	Apoptosis regulator Bcl-2
6	9606.ENSP00000328207	0.836	Tumor necrosis factor receptor superfamily member 18
7	9606.ENSP00000288207	0.833	G2/mitotic-specific cyclin-B2
8	9606.ENSP00000255120	0.792	Nuclear autoantigenic sperm protein
9	9606.ENSP00000410452	0.776	Stathmin
10	9606.ENSP00000431885	0.763	Non-receptor tyrosine-protein kinase TYK2
11	9606.ENSP00000269305	0.743	Cellular tumor antigen p53
12	9606.ENSP00000408005	0.727	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
13	9606.ENSP00000258149	0.709	E3 ubiquitin-protein ligase Mdm2
14	9606.ENSP00000318258	0.684	Cysteine/serine-rich nuclear protein 3
15	9606.ENSP00000304604	0.675	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
16	9606.ENSP00000432743	0.640	P53-regulated apoptosis-inducing protein 1
17	9606.ENSP00000323065	0.629	Growth arrest and DNA damage-inducible proteins-interacting protein 1
18	9606.ENSP00000375914	0.618	Rhomboid-related protein 4
19	9606.ENSP00000245903	0.606	CD70 antigen
20	9606.ENSP00000297532	0.602	Fas-activated serine/threonine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032813	1.000	tumor necrosis factor receptor superfamily binding
GO:0046914	0.997	transition metal ion binding
GO:0008270	0.994	zinc ion binding
GO:0005175	0.982	CD27 receptor binding
GO:0003824	0.401	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0012501	0.980	programmed cell death
GO:0023052	0.976	signaling
GO:0048518	0.976	positive regulation of biological process
GO:0007165	0.971	signal transduction
GO:0048522	0.968	positive regulation of cellular process
GO:0016043	0.967	cellular component organization
GO:0031323	0.965	regulation of cellular metabolic process
GO:0065009	0.963	regulation of molecular function
GO:0080090	0.963	regulation of primary metabolic process
GO:0006915	0.957	apoptotic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0010468	0.934	regulation of gene expression
GO:0097190	0.934	apoptotic signaling pathway
GO:0051179	0.917	localization
GO:0051128	0.912	regulation of cellular component organization
GO:0065008	0.907	regulation of biological quality
GO:0002376	0.874	immune system process
GO:0019219	0.869	regulation of nucleobase-containing compound metabolic process
GO:0051234	0.844	establishment of localization
GO:0051252	0.843	regulation of RNA metabolic process
GO:0010556	0.832	regulation of macromolecule biosynthetic process
GO:0031326	0.830	regulation of cellular biosynthetic process
GO:0006355	0.820	regulation of DNA-templated transcription
GO:0090559	0.815	regulation of membrane permeability
GO:0006839	0.815	mitochondrial transport
GO:0010821	0.807	regulation of mitochondrion organization
GO:0032501	0.797	multicellular organismal process
GO:0006996	0.783	organelle organization
GO:0002260	0.779	lymphocyte homeostasis
GO:0007166	0.747	cell surface receptor signaling pathway
GO:0046902	0.733	regulation of mitochondrial membrane permeability
GO:0043029	0.695	T cell homeostasis
GO:0051130	0.675	positive regulation of cellular component organization
GO:0044092	0.671	negative regulation of molecular function
GO:0010822	0.641	positive regulation of mitochondrion organization
GO:0043433	0.589	negative regulation of DNA-binding transcription factor activity
GO:0032088	0.486	negative regulation of NF-kappaB transcription factor activity
GO:0032879	0.445	regulation of localization
GO:0051049	0.437	regulation of transport
GO:0035556	0.413	intracellular signal transduction
GO:0097191	0.353	extrinsic apoptotic signaling pathway
GO:0071887	0.335	leukocyte apoptotic process
GO:0009893	0.331	positive regulation of metabolic process
GO:0048519	0.309	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0005739	0.707	mitochondrion
GO:0016020	0.540	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]