StarFunc result for job id O15305

User Input

>input (246 residues)
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDV
VEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFI
EFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISF
DVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRI
CELLFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4J6	1.000	1.000	1.051E-54	246	1.000	1.000	A0A0S2Z4J6.pdb.gz	A0A0S2Z4J6_HUMAN Phosphomannomutase (Fragment) OS=Homo sapiens OX=9606 GN=PMM2 PE=2 SV=1
2	PDB:7o0cA	0.941	0.956	5.503E-49	242	0.984	1.000	7o0cA.pdb.gz	Insight on molecular pathogenesis and pharmacochaperoning potential in phosphomannomutase 2 deficiency, provided by novel human phosphomannomutase 2 structures.
3	AFDB:Q7ZTZ3	0.962	0.946	2.743E-43	250	0.711	0.700	Q7ZTZ3.pdb.gz	Q7ZTZ3_DANRE Phosphomannomutase OS=Danio rerio OX=7955 GN=cb626 PE=1 SV=1
4	AFDB:A0A024R1U5	0.969	0.910	3.745E-43	262	0.667	0.626	A0A024R1U5.pdb.gz
5	PDB:2fueA	0.876	0.876	4.367E-41	246	0.667	0.667	2fueA.pdb.gz	The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a.
6	AFDB:A0A0U1WZ18	0.945	0.922	3.336E-39	252	0.589	0.575	A0A0U1WZ18.pdb.gz	PMM_DENOF Phosphomannomutase OS=Dendrobium officinale OX=142615 GN=PMM PE=1 SV=1
7	AFDB:A0A0K9RL25	0.955	0.948	7.045E-39	248	0.573	0.569	A0A0K9RL25.pdb.gz	PMM_SPIOL Phosphomannomutase OS=Spinacia oleracea OX=3562 GN=PMM PE=1 SV=1
8	AFDB:O80840	0.954	0.954	1.793E-38	246	0.610	0.610	O80840.pdb.gz	PMM_ARATH Phosphomannomutase OS=Arabidopsis thaliana OX=3702 GN=PMM PE=1 SV=1
9	AFDB:Q6FLW9	0.957	0.924	3.787E-38	255	0.577	0.557	Q6FLW9.pdb.gz	Q6FLW9_CANGA Phosphomannomutase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC53 PE=3 SV=1
10	AFDB:Q9UTJ2	0.960	0.919	7.061E-38	257	0.565	0.541	Q9UTJ2.pdb.gz	PMM_SCHPO Phosphomannomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmm1 PE=2 SV=1
11	AFDB:M2VWL5	0.950	0.931	7.515E-38	251	0.561	0.550	M2VWL5.pdb.gz	PMM_GALSU Phosphomannomutase OS=Galdieria sulphuraria OX=130081 GN=PMM PE=1 SV=1
12	AFDB:P07283	0.959	0.929	1.798E-37	254	0.581	0.563	P07283.pdb.gz	PMM_YEAST Phosphomannomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC53 PE=1 SV=1
13	PDB:5ue7A	0.912	0.895	7.720E-37	251	0.533	0.522	5ue7A.pdb.gz	Crystal structure of the phosphomannomutase PMM1 from Candida albicans, apoenzyme state
14	PDB:3f9rA	0.779	0.779	1.638E-34	246	0.508	0.508	3f9rA.pdb.gz	Crystal Structure of Trypanosoma Brucei phosphomannosemutase, TB.10.700.370
15	PDB:1u02A	0.532	0.562	1.954E-11	229	0.150	0.162	1u02A.pdb.gz	Crystal structure of trehalose-6-phosphate phosphatase-related protein: biochemical and biological implications.
16	PDB:5gvxA	0.579	0.401	4.973E-11	386	0.195	0.124	5gvxA.pdb.gz	Structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (OtsB2) from Mycobacterium tuberculosis.
17	PDB:2hf2B	0.566	0.523	1.440E-8	270	0.167	0.152	2hf2B.pdb.gz
18	PDB:1rkqA	0.580	0.534	2.228E-8	271	0.159	0.144	1rkqA.pdb.gz	Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.
19	PDB:4zevA	0.579	0.506	7.744E-8	290	0.159	0.134	4zevA.pdb.gz	Cap-domain closure enables diverse substrate recognition by the C2-type haloacid dehalogenase-like sugar phosphatase Plasmodium falciparum HAD1.
20	PDB:6rmoI	0.603	0.380	9.935E-8	432	0.203	0.116	6rmoI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4J6	0.0	508	246	1.000	1.000	A0A0S2Z4J6_HUMAN Phosphomannomutase (Fragment) OS=Homo sapiens OX=9606 GN=PMM2 PE=2 SV=1
2	O15305	0.0	508	246	1.000	1.000	PMM2_HUMAN Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1
3	Q9Z2M7	1.12e-164	456	242	0.890	0.905	PMM2_MOUSE Phosphomannomutase 2 OS=Mus musculus OX=10090 GN=Pmm2 PE=1 SV=1
4	H3BV55	2.50e-163	452	219	0.890	1.000	H3BV55_HUMAN Phosphomannomutase OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1
5	Q7ZTZ3	2.21e-132	375	250	0.711	0.700	Q7ZTZ3_DANRE Phosphomannomutase OS=Danio rerio OX=7955 GN=cb626 PE=1 SV=1
6	Q92871	6.51e-121	347	262	0.667	0.626	PMM1_HUMAN Phosphomannomutase 1 OS=Homo sapiens OX=9606 GN=PMM1 PE=1 SV=2
7	O35621	6.65e-121	346	262	0.667	0.626	PMM1_MOUSE Phosphomannomutase 1 OS=Mus musculus OX=10090 GN=Pmm1 PE=1 SV=1
8	O80840	5.16e-105	305	246	0.610	0.610	PMM_ARATH Phosphomannomutase OS=Arabidopsis thaliana OX=3702 GN=PMM PE=1 SV=1
9	Q6FLW9	6.67e-99	290	255	0.577	0.557	Q6FLW9_CANGA Phosphomannomutase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC53 PE=3 SV=1
10	A0A0U1WZ18	3.39e-98	288	252	0.606	0.591	PMM_DENOF Phosphomannomutase OS=Dendrobium officinale OX=142615 GN=PMM PE=1 SV=1
11	P07283	2.40e-97	286	254	0.581	0.563	PMM_YEAST Phosphomannomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC53 PE=1 SV=1
12	Q9UTJ2	9.85e-97	285	257	0.573	0.549	PMM_SCHPO Phosphomannomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmm1 PE=2 SV=1
13	M2VWL5	1.32e-95	282	251	0.569	0.558	PMM_GALSU Phosphomannomutase OS=Galdieria sulphuraria OX=130081 GN=PMM PE=1 SV=1
14	A0A0K9RL25	4.11e-95	280	248	0.573	0.569	PMM_SPIOL Phosphomannomutase OS=Spinacia oleracea OX=3562 GN=PMM PE=1 SV=1
15	Q9VTZ6	3.97e-93	276	254	0.533	0.516	PMM_DROME Phosphomannomutase OS=Drosophila melanogaster OX=7227 GN=Pmm2 PE=1 SV=1
16	P31353	6.69e-93	275	252	0.537	0.524	PMM_CANAL Phosphomannomutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMM1 PE=1 SV=1
17	Q38AW2	2.58e-81	245	245	0.504	0.506	Q38AW2_TRYB2 Phosphomannomutase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0370 PE=1 SV=1
18	P46891	0.65	33.1	272	0.098	0.088	COF_ECOLI HMP-PP phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=cof PE=1 SV=2
19	A2RTF1	3.2	31.6	1109	0.073	0.016	CTSRB_MOUSE Cation channel sperm-associated auxiliary subunit beta OS=Mus musculus OX=10090 GN=Catsperb PE=1 SV=1
20	Q94F10	6.6	30.0	198	0.073	0.091	Q94F10_ARATH Transmembrane protein, putative (DUF1118) OS=Arabidopsis thaliana OX=3702 GN=RIQ2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13419 HAD_2	5.5e+02	12.0	Haloacid dehalogenase-like hydrolase
2	PF00702 Hydrolase	5.3e+02	12.3	haloacid dehalogenase-like hydrolase
3	PF08282 Hydrolase_3	9.2e-07	40.4	haloacid dehalogenase-like hydrolase
4	PF03332 PMM	9.2e-111	380.5	Eukaryotic phosphomannomutase
5	PF05116 S6PP	2.3	19.3	Sucrose-6F-phosphate phosphohydrolase
6	PF13343 SBP_bac_6	1.1e+02	13.6	Bacterial extracellular solute-binding protein
7	PF08334 T2SSG	3.6e+02	12.6	Type II secretion system (T2SS), protein G
8	PF18043 T4_Rnl2_C	3.1e+02	13.1	T4 RNA ligase 2 C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318318	0.987	Mannose-6-phosphate isomerase
2	9606.ENSP00000309092	0.968	Mannose-1-phosphate guanyltransferase beta
3	9606.ENSP00000350949	0.928	Mannose-1-phosphate guanyltransferase alpha
4	9606.ENSP00000402103	0.909	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
5	9606.ENSP00000292432	0.907	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
6	9606.ENSP00000290573	0.905	Hexokinase-2
7	9606.ENSP00000346643	0.905	Putative hexokinase HKDC1
8	9606.ENSP00000216259	0.895	Phosphomannomutase 1
9	9606.ENSP00000417764	0.840	Alpha-1,3/1,6-mannosyltransferase ALG2
10	9606.ENSP00000361667	0.828	Dolichol kinase
11	9606.ENSP00000360149	0.823	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
12	9606.ENSP00000386597	0.819	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
13	9606.ENSP00000430236	0.816	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
14	9606.ENSP00000296292	0.791	Protein RFT1 homolog
15	9606.ENSP00000457718	0.764	Conserved oligomeric Golgi complex subunit 8
16	9606.ENSP00000358565	0.737	CMP-sialic acid transporter
17	9606.ENSP00000262374	0.720	Chitobiosyldiphosphodolichol beta-mannosyltransferase
18	9606.ENSP00000360644	0.696	Dolichol-phosphate mannosyltransferase subunit 1
19	9606.ENSP00000482396	0.689	Alpha-1,2-mannosyltransferase ALG9
20	9606.ENSP00000233616	0.680	Mannosyl-oligosaccharide glucosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004615	1.000	phosphomannomutase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044249	0.988	cellular biosynthetic process
GO:1901137	0.985	carbohydrate derivative biosynthetic process
GO:1901360	0.975	organic cyclic compound metabolic process
GO:0046483	0.975	heterocycle metabolic process
GO:0044281	0.972	small molecule metabolic process
GO:0006139	0.965	nucleobase-containing compound metabolic process
GO:0009226	0.962	nucleotide-sugar biosynthetic process
GO:1901564	0.753	organonitrogen compound metabolic process
GO:0043170	0.548	macromolecule metabolic process
GO:0070085	0.521	glycosylation
GO:0009100	0.509	glycoprotein metabolic process
GO:0036211	0.471	protein modification process
GO:0006486	0.463	protein glycosylation
GO:0009298	0.406	GDP-mannose biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0070013	0.988	intracellular organelle lumen
GO:0005634	0.988	nucleus
GO:0005654	0.935	nucleoplasm
GO:0012505	0.507	endomembrane system
GO:0016020	0.487	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11140	1.000	alpha-D-mannose 1-phosphate = D-mannose 6-phosphate
EC:5.4.2.8	1.000	phosphomannomutase.

[back to server]