StarFunc result for job id O15315

User Input

>input (384 residues)
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRAC
APKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIM
MSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLY
RELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREAS
SLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWA
PEILPPQPPEQLGLQMCHHTQLIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15315	1.000	1.000	9.663E-77	384	1.000	1.000	O15315.pdb.gz	RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2
2	AFDB:O35719	0.859	0.941	2.396E-60	350	0.771	0.846	O35719.pdb.gz	RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus OX=10090 GN=Rad51b PE=2 SV=2
3	AFDB:Q9SK02	0.685	0.708	1.151E-33	370	0.276	0.286	Q9SK02.pdb.gz	RA51B_ARATH DNA repair protein RAD51 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=RAD51B PE=2 SV=2
4	AFDB:Q8R2J9	0.637	0.667	9.790E-30	366	0.271	0.284	Q8R2J9.pdb.gz	RA51C_CRIGR DNA repair protein RAD51 homolog 3 OS=Cricetulus griseus OX=10029 GN=RAD51C PE=2 SV=1
5	AFDB:J9PFC8	0.600	0.657	1.102E-28	349	0.247	0.272	J9PFC8.pdb.gz	J9PFC8_ORYSA RAD51C-1 OS=Oryza sativa OX=4530 GN=RAD51C PE=4 SV=1
6	AFDB:O43502	0.639	0.651	1.310E-28	376	0.284	0.290	O43502.pdb.gz	RA51C_HUMAN DNA repair protein RAD51 homolog 3 OS=Homo sapiens OX=9606 GN=RAD51C PE=1 SV=1
7	AFDB:F4IW45	0.595	0.591	1.170E-27	387	0.260	0.258	F4IW45.pdb.gz	F4IW45_ARATH RAS associated with diabetes protein 51C OS=Arabidopsis thaliana OX=3702 GN=RAD51C PE=4 SV=1
8	AFDB:P25453	0.677	0.770	5.547E-27	334	0.245	0.281	P25453.pdb.gz	DMC1_YEAST Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMC1 PE=1 SV=1
9	AFDB:O43542	0.690	0.756	5.876E-27	346	0.247	0.275	O43542.pdb.gz	XRCC3_HUMAN DNA repair protein XRCC3 OS=Homo sapiens OX=9606 GN=XRCC3 PE=1 SV=1
10	AFDB:D4A5N4	0.665	0.724	1.046E-26	349	0.224	0.246	D4A5N4.pdb.gz	D4A5N4_RAT DNA repair protein OS=Rattus norvegicus OX=10116 GN=Xrcc3 PE=3 SV=2
11	PDB:7ej6B	0.671	0.804	1.022E-23	316	0.258	0.313	7ej6B.pdb.gz	Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
12	PDB:1xu4A	0.643	0.762	3.846E-23	318	0.206	0.248	1xu4A.pdb.gz	Crystal structure of an ATPase-active form of Rad51 homolog from Methanococcus voltae. Insights into potassium dependence
13	PDB:3ldaA	0.600	0.762	1.027E-21	293	0.216	0.283	3ldaA.pdb.gz
14	PDB:7c98A	0.668	0.816	1.033E-19	309	0.216	0.269	7c98A.pdb.gz	Identification of fidelity-governing factors in human recombinases DMC1 and RAD51 from cryo-EM structures.
15	PDB:3fyhA	0.590	0.747	1.159E-19	296	0.198	0.257	3fyhA.pdb.gz	Crystal structure of an archaeal Rad51 homologue in complex with a metatungstate inhibitor.
16	PDB:5jzcA	0.654	0.789	2.185E-19	312	0.232	0.285	5jzcA.pdb.gz
17	PDB:4esvC	0.471	0.422	1.182E-12	434	0.141	0.124	4esvC.pdb.gz	The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.
18	PDB:3cmtD	0.484	0.123	3.532E-12	1609	0.143	0.034	3cmtD.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.
19	PDB:7dy1D	0.447	0.381	3.532E-12	458	0.135	0.114	7dy1D.pdb.gz	Regulation mechanisms of the dual ATPase in KaiC.
20	PDB:4nmnA	0.479	0.440	5.287E-12	425	0.141	0.127	4nmnA.pdb.gz	Nucleotide and partner-protein control of bacterial replicative helicase structure and function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15315	0.0	785	384	1.000	1.000	RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2
2	O35719	0.0	600	350	0.771	0.846	RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus OX=10090 GN=Rad51b PE=2 SV=2
3	Q9SK02	2.46e-51	177	370	0.273	0.284	RA51B_ARATH DNA repair protein RAD51 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=RAD51B PE=2 SV=2
4	F4IW45	7.62e-32	125	387	0.232	0.230	F4IW45_ARATH RAS associated with diabetes protein 51C OS=Arabidopsis thaliana OX=3702 GN=RAD51C PE=4 SV=1
5	A0A1D8PFE4	1.01e-31	124	324	0.266	0.315	A0A1D8PFE4_CANAL Recombinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DLH1 PE=3 SV=1
6	J9PFC8	2.80e-31	123	349	0.229	0.252	J9PFC8_ORYSA RAD51C-1 OS=Oryza sativa OX=4530 GN=RAD51C PE=4 SV=1
7	Q9FKM5	4.12e-31	122	304	0.232	0.293	XRCC3_ARATH DNA repair protein XRCC3 homolog OS=Arabidopsis thaliana OX=3702 GN=XRCC3 PE=1 SV=1
8	C8VSQ3	8.94e-31	122	348	0.234	0.259	C8VSQ3_EMENI DNA repair protein RAD51 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01237 PE=3 SV=1
9	P25453	1.36e-30	121	334	0.268	0.308	DMC1_YEAST Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMC1 PE=1 SV=1
10	P70099	1.21e-29	119	339	0.242	0.274	RAD51_CRIGR DNA repair protein RAD51 homolog 1 OS=Cricetulus griseus OX=10029 GN=RAD51 PE=2 SV=1
11	Q06609	1.43e-29	119	339	0.242	0.274	RAD51_HUMAN DNA repair protein RAD51 homolog 1 OS=Homo sapiens OX=9606 GN=RAD51 PE=1 SV=1
12	Q08297	3.66e-29	117	339	0.242	0.274	RAD51_MOUSE DNA repair protein RAD51 homolog 1 OS=Mus musculus OX=10090 GN=Rad51 PE=1 SV=1
13	Q5TYR1	4.75e-29	117	340	0.242	0.274	Q5TYR1_DANRE DNA repair protein RAD51 homolog OS=Danio rerio OX=7955 GN=wu:fb38e12 PE=1 SV=1
14	P37383	5.71e-29	117	339	0.242	0.274	RAD51_CHICK DNA repair protein RAD51 homolog 1 OS=Gallus gallus OX=9031 GN=RAD51A PE=2 SV=1
15	F7EX62	7.44e-29	116	318	0.232	0.280	F7EX62_RAT DNA repair protein RAD51 homolog OS=Rattus norvegicus OX=10116 GN=Rad51 PE=3 SV=1
16	P36601	1.01e-28	117	365	0.240	0.252	RAD51_SCHPO DNA repair protein rhp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp51 PE=1 SV=1
17	O43502	2.81e-28	115	376	0.258	0.263	RA51C_HUMAN DNA repair protein RAD51 homolog 3 OS=Homo sapiens OX=9606 GN=RAD51C PE=1 SV=1
18	J3QKK3	1.60e-27	113	346	0.240	0.266	J3QKK3_HUMAN RAD51 paralog C OS=Homo sapiens OX=9606 GN=RAD51C PE=1 SV=1
19	Q59UY8	1.98e-27	113	361	0.245	0.260	Q59UY8_CANAL DNA repair protein RAD51 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD51 PE=3 SV=1
20	O42634	5.17e-27	111	332	0.237	0.274	DMC1_SCHPO Meiotic recombination protein dmc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dmc1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.1e+02	13.8	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	2.9e+02	12.6	AAA domain
3	PF13479 AAA_24	4.9	18.4	AAA domain
4	PF13481 AAA_25	6.7e-06	37.3	AAA domain
5	PF00005 ABC_tran	6e+02	12.3	ABC transporter
6	PF06745 ATPase	0.00036	31.5	KaiC
7	PF01637 ATPase_2	86	14.5	ATPase domain predominantly from Archaea
8	PF03796 DnaB_C	0.00017	32.5	DnaB-like helicase C terminal domain
9	PF08423 Rad51	5.1e-48	175.1	Rad51
10	PF00154 RecA	0.02	26.0	recA bacterial DNA recombination protein
11	PF05621 TniB	2.5e+02	12.5	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336701	0.996	DNA repair protein RAD51 homolog 3
2	9606.ENSP00000466834	0.996	annotation not available
3	9606.ENSP00000352271	0.992	DNA repair protein XRCC2
4	9606.ENSP00000466399	0.988	Uncharacterized protein
5	9606.ENSP00000307853	0.980	Crossover junction endonuclease MUS81
6	9606.ENSP00000254719	0.976	Replication protein A 70 kDa DNA-binding subunit
7	9606.ENSP00000371469	0.973	Cell cycle checkpoint protein RAD1
8	9606.ENSP00000451974	0.973	DNA repair protein XRCC3
9	9606.ENSP00000318977	0.970	Flap endonuclease GEN homolog 1
10	9606.ENSP00000369497	0.965	Breast cancer type 2 susceptibility protein
11	9606.ENSP00000406046	0.957	DNA polymerase delta catalytic subunit
12	9606.ENSP00000322570	0.956	DNA polymerase epsilon catalytic subunit A
13	9606.ENSP00000368458	0.947	Proliferating cell nuclear antigen
14	9606.ENSP00000361310	0.944	DNA polymerase eta
15	9606.ENSP00000371321	0.940	Replication factor C subunit 1
16	9606.ENSP00000418960	0.940	Breast cancer type 1 susceptibility protein
17	9606.ENSP00000376952	0.939	Crossover junction endonuclease EME1
18	9606.ENSP00000351284	0.938	DNA repair protein RAD52 homolog
19	9606.ENSP00000241436	0.935	DNA polymerase kappa
20	9606.ENSP00000267430	0.935	Fanconi anemia group M protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0003697	1.000	single-stranded DNA binding
GO:0000217	0.997	DNA secondary structure binding
GO:0003690	0.995	double-stranded DNA binding
GO:0000400	0.992	four-way junction DNA binding
GO:0042802	0.502	identical protein binding
GO:0016787	0.403	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0044238	0.982	primary metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0050896	0.978	response to stimulus
GO:0006807	0.978	nitrogen compound metabolic process
GO:0050789	0.977	regulation of biological process
GO:0043170	0.976	macromolecule metabolic process
GO:0050794	0.967	regulation of cellular process
GO:0006281	0.966	DNA repair
GO:0006302	0.961	double-strand break repair
GO:0006310	0.937	DNA recombination
GO:0000725	0.917	recombinational repair
GO:0007131	0.894	reciprocal meiotic recombination
GO:0000724	0.893	double-strand break repair via homologous recombination
GO:0048522	0.889	positive regulation of cellular process
GO:1901987	0.872	regulation of cell cycle phase transition
GO:1901990	0.725	regulation of mitotic cell cycle phase transition
GO:1902749	0.688	regulation of cell cycle G2/M phase transition
GO:0090068	0.617	positive regulation of cell cycle process
GO:0010389	0.584	regulation of G2/M transition of mitotic cell cycle
GO:1901989	0.536	positive regulation of cell cycle phase transition
GO:1902751	0.514	positive regulation of cell cycle G2/M phase transition
GO:0045931	0.473	positive regulation of mitotic cell cycle
GO:0010971	0.322	positive regulation of G2/M transition of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005694	0.998	chromosome
GO:0032991	0.997	protein-containing complex
GO:0140513	0.949	nuclear protein-containing complex
GO:0005657	0.866	replication fork
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.403	Hydrolases.

[back to server]