StarFunc result for job id O15318

User Input

>input (223 residues)
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG
PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAM1	0.302	0.302	5.200E-27	223	1.000	1.000	A0A024RAM1.pdb.gz
2	AFDB:Q6NXY9	0.241	0.241	1.542E-22	223	0.830	0.830	Q6NXY9.pdb.gz	RPC7_MOUSE DNA-directed RNA polymerase III subunit RPC7 OS=Mus musculus OX=10090 GN=Polr3g PE=2 SV=1
3	PDB:7a6hQ	0.249	0.449	5.276E-12	104	0.466	1.000	7a6hQ.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
4	AFDB:Q8R0C0	0.219	0.222	1.620E-11	218	0.462	0.472	Q8R0C0.pdb.gz	RPC7L_MOUSE DNA-directed RNA polymerase III subunit RPC7-like OS=Mus musculus OX=10090 GN=Polr3gl PE=2 SV=2
5	PDB:7d59Q	0.228	0.372	1.073E-9	121	0.529	0.975	7d59Q.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
6	PDB:7dn3Q	0.101	0.198	4.148E-5	86	0.381	0.988	7dn3Q.pdb.gz	Structure of human RNA polymerase III elongation complex.
7	PDB:7z1lQ	0.170	0.282	8.823E-1	123	0.081	0.146	7z1lQ.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
8	PDB:7o4iW	0.115	0.086	4.066	312	0.126	0.090	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
9	AFDB:Q9SDQ3	0.095	0.042	4.924	593	0.126	0.047	Q9SDQ3.pdb.gz	SCL1_ARATH Scarecrow-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=SCL1 PE=2 SV=1
10	AFDB:Q8IAM0	0.085	0.019	5.263	1397	0.135	0.021	Q8IAM0.pdb.gz	Q8IAM0_PLAF7 Glutamate dehydrogenase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802000 PE=3 SV=1
11	AFDB:Q38B17	0.093	0.052	6.423	478	0.108	0.050	Q38B17.pdb.gz	Q38B17_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1070 PE=4 SV=1
12	AFDB:A6NEL2	0.097	0.035	6.864	793	0.130	0.037	A6NEL2.pdb.gz	SWAHB_HUMAN Ankyrin repeat domain-containing protein SOWAHB OS=Homo sapiens OX=9606 GN=SOWAHB PE=1 SV=1
13	AFDB:Q9BSD3	0.111	0.104	7.336	238	0.108	0.101	Q9BSD3.pdb.gz	RHNO1_HUMAN RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 OS=Homo sapiens OX=9606 GN=RHNO1 PE=1 SV=1
14	AFDB:A0A1L8H8C0	0.105	0.033	7.840	956	0.126	0.029	A0A1L8H8C0.pdb.gz	G2L2S_XENLA GAS2-like protein 2B OS=Xenopus laevis OX=8355 GN=gas2l2.S PE=3 SV=1
15	AFDB:P03966	0.086	0.055	7.840	462	0.135	0.065	P03966.pdb.gz	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15318	2.71e-160	443	223	1.000	1.000	RPC7_HUMAN DNA-directed RNA polymerase III subunit RPC7 OS=Homo sapiens OX=9606 GN=POLR3G PE=1 SV=2
2	D6R9U7	1.20e-157	437	220	0.987	1.000	D6R9U7_HUMAN RNA polymerase III subunit G (Fragment) OS=Homo sapiens OX=9606 GN=POLR3G PE=1 SV=8
3	Q6NXY9	4.31e-111	319	223	0.812	0.812	RPC7_MOUSE DNA-directed RNA polymerase III subunit RPC7 OS=Mus musculus OX=10090 GN=Polr3g PE=2 SV=1
4	D6RIT0	5.02e-62	190	92	0.413	1.000	D6RIT0_HUMAN RNA polymerase III subunit G (Fragment) OS=Homo sapiens OX=9606 GN=POLR3G PE=1 SV=1
5	D6RJH6	3.28e-54	171	100	0.368	0.820	D6RJH6_HUMAN RNA polymerase III subunit G OS=Homo sapiens OX=9606 GN=POLR3G PE=1 SV=1
6	Q9BT43	2.08e-37	132	218	0.439	0.450	RPC7L_HUMAN DNA-directed RNA polymerase III subunit RPC7-like OS=Homo sapiens OX=9606 GN=POLR3GL PE=1 SV=1
7	Q8R0C0	1.25e-35	127	218	0.444	0.454	RPC7L_MOUSE DNA-directed RNA polymerase III subunit RPC7-like OS=Mus musculus OX=10090 GN=Polr3gl PE=2 SV=2
8	D6REQ0	4.88e-21	84.3	39	0.175	1.000	D6REQ0_HUMAN RNA polymerase III subunit G (Fragment) OS=Homo sapiens OX=9606 GN=POLR3G PE=1 SV=1
9	Q8II80	0.002	41.6	1570	0.085	0.012	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
10	Q9NU22	0.41	34.3	5596	0.094	0.004	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2
11	M9PF84	0.61	33.5	818	0.117	0.032	M9PF84_DROME Klumpfuss, isoform B OS=Drosophila melanogaster OX=7227 GN=klu PE=4 SV=1
12	O01348	0.68	33.5	750	0.117	0.035	O01348_DROME Klu protein OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
13	Q5BIH1	0.72	33.1	803	0.117	0.032	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
14	Q9VTD3	0.80	33.1	803	0.117	0.032	Q9VTD3_DROME FI01015p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=2
15	Q4GZD0	1.1	32.7	4600	0.081	0.004	Q4GZD0_TRYB2 Midasin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.880 PE=3 SV=1
16	Q9LK91	10.0	29.6	652	0.139	0.048	PDP6_ARATH PWWP domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=PDP6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09073 BUD22	9.9e+02	10.4	BUD22
2	PF11705 RNA_pol_3_Rpc31	7.7e-29	112.7	DNA-directed RNA polymerase III subunit Rpc31
3	PF04499 SAPS	6.6e+02	10.5	SIT4 phosphatase-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382058

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366828	0.999	DNA-directed RNA polymerase III subunit RPC6
2	9606.ENSP00000334564	0.998	DNA-directed RNA polymerase III subunit RPC3
3	9606.ENSP00000347345	0.997	DNA-directed RNA polymerase III subunit RPC8
4	9606.ENSP00000299853	0.995	DNA-directed RNA polymerase III subunit RPC5
5	9606.ENSP00000380904	0.994	DNA-directed RNA polymerase III subunit RPC4
6	9606.ENSP00000228347	0.992	DNA-directed RNA polymerase III subunit RPC2
7	9606.ENSP00000361446	0.988	DNA-directed RNA polymerase III subunit RPC1
8	9606.ENSP00000361465	0.983	DNA-directed RNA polymerases I and III subunit RPAC1
9	9606.ENSP00000380781	0.912	Nuclear factor 1 X-type
10	9606.ENSP00000358320	0.905	DNA-directed RNA polymerase III subunit RPC7-like
11	9606.ENSP00000360231	0.905	Nuclear factor 1 A-type
12	9606.ENSP00000386636	0.903	Lupus La protein
13	9606.ENSP00000370340	0.900	Nuclear factor 1 B-type
14	9606.ENSP00000396843	0.900	Nuclear factor 1 C-type
15	9606.ENSP00000403852	0.881	DNA-directed RNA polymerases I, II, and III subunit RPABC2
16	9606.ENSP00000478303	0.878	DNA-directed RNA polymerases I, II, and III subunit RPABC1
17	9606.ENSP00000351575	0.803	Transcription factor TFIIIB component B'' homolog
18	9606.ENSP00000361180	0.796	General transcription factor 3C polypeptide 5
19	9606.ENSP00000348510	0.791	General transcription factor 3C polypeptide 1
20	9606.ENSP00000378736	0.789	DNA-directed RNA polymerase III subunit RPC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0005515	0.996	protein binding
GO:0003824	0.989	catalytic activity
GO:0016740	0.961	transferase activity
GO:0016772	0.950	transferase activity, transferring phosphorus-containing groups
GO:0016779	0.907	nucleotidyltransferase activity
GO:0034062	0.885	5'-3' RNA polymerase activity
GO:0003899	0.876	DNA-directed 5'-3' RNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006383	0.987	transcription by RNA polymerase III
GO:0010468	0.956	regulation of gene expression
GO:0048518	0.925	positive regulation of biological process
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:0050794	0.842	regulation of cellular process
GO:0032479	0.842	regulation of type I interferon production
GO:0009889	0.797	regulation of biosynthetic process
GO:0019219	0.796	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.794	regulation of RNA metabolic process
GO:0006355	0.781	regulation of DNA-templated transcription
GO:0001819	0.767	positive regulation of cytokine production
GO:0032481	0.755	positive regulation of type I interferon production
GO:0008283	0.747	cell population proliferation
GO:0032648	0.679	regulation of interferon-beta production
GO:0032728	0.453	positive regulation of interferon-beta production
GO:0050776	0.427	regulation of immune response
GO:0031347	0.427	regulation of defense response
GO:0032101	0.388	regulation of response to external stimulus
GO:0032103	0.341	positive regulation of response to external stimulus
GO:0002831	0.340	regulation of response to biotic stimulus
GO:0050778	0.334	positive regulation of immune response
GO:0045088	0.333	regulation of innate immune response
GO:0006359	0.318	regulation of transcription by RNA polymerase III
GO:0045089	0.316	positive regulation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.996	cytosol
GO:0016604	0.938	nuclear body
GO:0032991	0.716	protein-containing complex
GO:0030880	0.505	RNA polymerase complex
GO:0055029	0.502	nuclear DNA-directed RNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.961	Transferases.
EC:2.7.-.-	0.950	Transferring phosphorus-containing groups.
EC:2.7.7.-	0.907	Nucleotidyltransferases.
RHEA:21248	0.885	a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)
EC:2.7.7.6	0.876	DNA-directed RNA polymerase.

[back to server]