StarFunc result for job id O15327

User Input

>input (924 residues)
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLN
TLVQISVIHPVEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDK
SHDTVRTSVLPEHKDPPPEVGRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIE
VSVVKMGEIEDGEADHITTDVQGQKCALVCECTAPESVSGKDNLPFLNSVLKNPVCKLYR
FPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRNQEIKELGELSPHWDNLRKNV
LTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
ILKKPPSPKSSTEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
KLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
SLTFVLLQELAYSLPQCLMLTLRRDIVFSQALAGLVCGFIIKLQTSLYDPGFLQQLHTVG
LIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEVK
LPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESINQENFELLQEY
YKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAF
NMLQLMAFPKYYRPPEGTYGKADT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QWG5	0.946	0.942	0.000	928	0.908	0.904	Q9QWG5.pdb.gz	INP4B_RAT Type II inositol 3,4-bisphosphate 4-phosphatase OS=Rattus norvegicus OX=10116 GN=Inpp4b PE=1 SV=1
2	AFDB:Q96PE3	0.806	0.764	4.209E-90	977	0.453	0.429	Q96PE3.pdb.gz	INP4A_HUMAN Inositol polyphosphate-4-phosphatase type I A OS=Homo sapiens OX=9606 GN=INPP4A PE=1 SV=1
3	AFDB:Q62784	0.822	0.809	9.021E-90	939	0.446	0.439	Q62784.pdb.gz	INP4A_RAT Inositol polyphosphate-4-phosphatase type I A OS=Rattus norvegicus OX=10116 GN=Inpp4a PE=1 SV=1
4	AFDB:F1R6J2	0.481	0.284	1.242E-29	1622	0.170	0.097	F1R6J2.pdb.gz	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
5	AFDB:Q70Z35	0.540	0.323	3.378E-29	1606	0.168	0.097	Q70Z35.pdb.gz	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
6	AFDB:Q8TCU6	0.469	0.271	2.272E-28	1659	0.176	0.098	Q8TCU6.pdb.gz	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
7	PDB:6pcvA	0.390	0.474	3.768E-18	754	0.124	0.153	6pcvA.pdb.gz
8	AFDB:Q8IYJ1	0.143	0.228	5.964E-7	553	0.049	0.081	Q8IYJ1.pdb.gz	CPNE9_HUMAN Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3
9	AFDB:Q7YXU4	0.136	0.202	7.216E-7	600	0.042	0.065	Q7YXU4.pdb.gz	CPNA_DICDI Copine-A OS=Dictyostelium discoideum OX=44689 GN=cpnA PE=2 SV=1
10	AFDB:Q86YQ8	0.142	0.226	1.108E-6	564	0.047	0.076	Q86YQ8.pdb.gz	CPNE8_HUMAN Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8 PE=1 SV=2
11	AFDB:Q5S1W2	0.139	0.214	1.547E-6	586	0.040	0.063	Q5S1W2.pdb.gz	BON2_ARATH Protein BONZAI 2 OS=Arabidopsis thaliana OX=3702 GN=BON2 PE=1 SV=2
12	PDB:6kxkD	0.129	0.211	1.585E-5	553	0.028	0.047	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:1cjyA	0.100	0.138	7.886E-4	633	0.023	0.033	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5iz5B	0.110	0.133	7.886E-4	746	0.026	0.032	5iz5B.pdb.gz
15	PDB:3pfqA	0.095	0.158	1.050E-3	523	0.037	0.065	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
16	PDB:5a50A	0.106	0.462	1.155E-3	165	0.025	0.139	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:4gnkB	0.107	0.127	2.250E-3	769	0.023	0.027	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
18	PDB:5ixcA	0.103	0.134	2.475E-3	684	0.023	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:5izrC	0.101	0.137	8.543E-3	659	0.022	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	PDB:5itdA	0.109	0.102	1.251E-2	995	0.026	0.024	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15327	0.0	1920	924	1.000	1.000	INP4B_HUMAN Inositol polyphosphate 4-phosphatase type II OS=Homo sapiens OX=9606 GN=INPP4B PE=1 SV=4
2	Q62784	0.0	761	939	0.446	0.439	INP4A_RAT Inositol polyphosphate-4-phosphatase type I A OS=Rattus norvegicus OX=10116 GN=Inpp4a PE=1 SV=1
3	Q6P1Y8	0.0	1578	924	0.851	0.851	INP4B_MOUSE Type II inositol 3,4-bisphosphate 4-phosphatase OS=Mus musculus OX=10090 GN=Inpp4b PE=2 SV=1
4	Q96PE3	0.0	755	977	0.450	0.426	INP4A_HUMAN Inositol polyphosphate-4-phosphatase type I A OS=Homo sapiens OX=9606 GN=INPP4A PE=1 SV=1
5	Q9EPW0	0.0	756	939	0.446	0.439	INP4A_MOUSE Inositol polyphosphate-4-phosphatase type I A OS=Mus musculus OX=10090 GN=Inpp4a PE=1 SV=1
6	Q9QWG5	0.0	1716	928	0.909	0.905	INP4B_RAT Type II inositol 3,4-bisphosphate 4-phosphatase OS=Rattus norvegicus OX=10116 GN=Inpp4b PE=1 SV=1
7	Q3LAC4	8.53e-24	110	1598	0.102	0.059	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
8	Q70Z35	1.22e-23	110	1606	0.115	0.066	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
9	A0A8I6GLR6	1.41e-21	103	1646	0.101	0.057	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
10	D3ZS72	1.47e-21	103	1635	0.101	0.057	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
11	Q69ZK0	3.67e-21	102	1650	0.101	0.056	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
12	F1R6J2	4.43e-21	102	1622	0.089	0.051	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
13	Q8TCU6	5.39e-21	102	1659	0.107	0.060	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
14	Q8IYJ1	0.90	35.8	553	0.037	0.061	CPNE9_HUMAN Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3
15	C7BKP9	0.92	35.8	2957	0.036	0.011	PATOX_PHOAA Toxin PAU_02230 OS=Photorhabdus asymbiotica subsp. asymbiotica (strain ATCC 43949 / 3105-77) OX=553480 GN=PAU_02230 PE=1 SV=1
16	Q54XS3	4.1	33.9	1661	0.035	0.019	GDT1_DICDI Probable inactive serine/threonine-protein kinase gdt1 OS=Dictyostelium discoideum OX=44689 GN=gdt1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10484 MRP-S23	4.4e+02	12.5	Mitochondrial ribosomal protein S23
2	PF08788 NHR2	24	16.1	NHR2 domain like
3	PF10496 Syntaxin-18_N	3.4e+02	12.9	SNARE-complex protein Syntaxin-18 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361021	0.971	Phosphatase and tensin homolog
2	9606.ENSP00000298229	0.959	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
3	9606.ENSP00000428056	0.954	Phosphatidylinositol 3-kinase regulatory subunit alpha
4	9606.ENSP00000265970	0.946	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
5	9606.ENSP00000356155	0.944	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
6	9606.ENSP00000362115	0.942	Type II inositol 1,4,5-trisphosphate 5-phosphatase
7	9606.ENSP00000230124	0.940	Polyphosphoinositide phosphatase
8	9606.ENSP00000405338	0.939	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
9	9606.ENSP00000360154	0.938	Inositol polyphosphate 5-phosphatase OCRL-1
10	9606.ENSP00000360777	0.937	72 kDa inositol polyphosphate 5-phosphatase
11	9606.ENSP00000413937	0.937	Inositol polyphosphate 5-phosphatase K
12	9606.ENSP00000222254	0.934	Phosphatidylinositol 3-kinase regulatory subunit beta
13	9606.ENSP00000262039	0.933	Phosphatidylinositol 3-kinase catalytic subunit type 3
14	9606.ENSP00000445381	0.931	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
15	9606.ENSP00000262741	0.928	Phosphatidylinositol 3-kinase regulatory subunit gamma
16	9606.ENSP00000264380	0.925	1-phosphatidylinositol 3-phosphate 5-kinase
17	9606.ENSP00000347792	0.924	Synaptojanin-2
18	9606.ENSP00000357583	0.924	Type I inositol 1,4,5-trisphosphate 5-phosphatase
19	9606.ENSP00000409667	0.920	Synaptojanin-1
20	9606.ENSP00000359423	0.919	Myotubularin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016316	1.000	phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity
GO:0005488	0.985	binding
GO:0005515	0.965	protein binding
GO:0052745	0.424	inositol phosphate phosphatase activity
GO:0046030	0.383	inositol trisphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0065007	0.985	biological regulation
GO:0006793	0.973	phosphorus metabolic process
GO:0050789	0.970	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0043647	0.951	inositol phosphate metabolic process
GO:0046488	0.941	phosphatidylinositol metabolic process
GO:0046474	0.936	glycerophospholipid biosynthetic process
GO:0023052	0.803	signaling
GO:0050896	0.794	response to stimulus
GO:0006661	0.764	phosphatidylinositol biosynthetic process
GO:0051716	0.688	cellular response to stimulus
GO:0007154	0.658	cell communication
GO:0016311	0.545	dephosphorylation
GO:0007165	0.458	signal transduction
GO:0030258	0.305	lipid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.867	membrane
GO:0043226	0.853	organelle
GO:0043231	0.797	intracellular membrane-bounded organelle
GO:0005634	0.736	nucleus
GO:0031974	0.635	membrane-enclosed lumen
GO:0070013	0.630	intracellular organelle lumen
GO:0005654	0.594	nucleoplasm
GO:0012505	0.576	endomembrane system
GO:0031090	0.575	organelle membrane
GO:0071944	0.411	cell periphery
GO:0031967	0.386	organelle envelope
GO:0005886	0.381	plasma membrane
GO:0031965	0.332	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17193	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + phosphate
EC:3.1.3.66	1.000	phosphatidylinositol-3,4-bisphosphate 4-phosphatase.

[back to server]