StarFunc result for job id O15344

User Input

>input (667 residues)
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70583	0.688	0.678	0.000	680	0.951	0.932	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
2	AFDB:Q9UJV3	0.658	0.608	5.487E-99	735	0.759	0.688	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
3	AFDB:Q505D9	0.333	0.294	6.313E-44	768	0.276	0.240	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
4	AFDB:Q91ZY8	0.285	0.270	1.411E-43	710	0.274	0.258	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
5	AFDB:Q80WG7	0.280	0.260	6.005E-43	729	0.268	0.246	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
6	AFDB:A0A0G2JXN2	0.451	0.410	6.358E-42	759	0.267	0.235	A0A0G2JXN2.pdb.gz	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
7	AFDB:Q8C7M3	0.307	0.257	1.858E-41	817	0.271	0.222	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
8	AFDB:Q9UAQ3	0.295	0.265	2.447E-39	765	0.244	0.213	Q9UAQ3.pdb.gz	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
9	AFDB:M9MRI4	0.297	0.271	8.896E-38	740	0.268	0.242	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
10	AFDB:Q1LY10	0.337	0.432	2.763E-35	495	0.220	0.297	Q1LY10.pdb.gz	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
11	PDB:7y4sA	0.240	0.455	3.418E-13	343	0.106	0.207	7y4sA.pdb.gz
12	PDB:4b3nA	0.208	0.247	2.787E-10	557	0.055	0.066	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7nscA	0.223	0.512	8.205E-8	276	0.049	0.120	7nscA.pdb.gz
14	PDB:7ccbA	0.196	0.729	2.398E-7	164	0.045	0.183	7ccbA.pdb.gz
15	PDB:6pxvA	0.142	0.120	1.567E-6	823	0.052	0.043	6pxvA.pdb.gz
16	PDB:7z36B	0.227	0.309	3.147E-6	446	0.088	0.132	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
17	PDB:6swy1	0.190	0.229	2.056E-5	542	0.045	0.055	6swy1.pdb.gz
18	PDB:7u7nC	0.120	0.352	7.449E-5	200	0.052	0.175	7u7nC.pdb.gz
19	PDB:6pyhD	0.143	0.122	1.854E-4	798	0.058	0.049	6pyhD.pdb.gz
20	PDB:8dtlA	0.144	0.133	1.854E-4	741	0.046	0.042	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J453	0.0	999	483	0.724	1.000	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
2	O15344	0.0	1392	667	1.000	1.000	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
3	O70583	0.0	1328	680	0.952	0.934	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
4	Q9UJV3	0.0	1091	735	0.760	0.690	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
5	Q80WG7	5.09e-67	235	729	0.286	0.262	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
6	Q9NQ86	5.53e-65	230	728	0.277	0.254	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
7	Q1LY10	7.09e-64	221	495	0.226	0.305	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
8	Q9BTV5	7.57e-62	216	496	0.219	0.294	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
9	A0A0G2JXN2	1.72e-61	221	759	0.282	0.248	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
10	Q7TNM2	2.14e-61	220	759	0.282	0.248	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
11	Q91ZY8	1.66e-52	194	710	0.255	0.239	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
12	Q9C026	5.96e-52	193	710	0.253	0.238	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
13	Q505D9	1.81e-46	178	768	0.228	0.198	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
14	M9MRI4	1.30e-40	160	740	0.232	0.209	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
15	Q08CC1	4.71e-40	157	573	0.247	0.288	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
16	Q8C7M3	4.28e-37	150	817	0.172	0.141	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
17	Q38HM4	9.42e-37	143	350	0.156	0.297	TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus OX=10090 GN=Trim63 PE=1 SV=1
18	Q91Z63	4.04e-36	141	351	0.156	0.296	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
19	Q969Q1	6.80e-36	140	353	0.154	0.292	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
20	Q14258	1.14e-34	142	630	0.241	0.256	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18568 COS	1.7e-28	109.8	TRIM C-terminal subgroup One Signature domain
2	PF00041 fn3	6.6e-05	34.5	Fibronectin type III domain
3	PF10179 NDNF	3.5e+02	12.7	Neuron-derived neurotrophic factor, first Fn(III) domain
4	PF13765 PRY	0.0012	29.8	SPRY-associated domain
5	PF16656 Pur_ac_phosph_N	24	17.0	Purple acid Phosphatase, N-terminal domain
6	PF00622 SPRY	2.1e-14	65.0	SPRY domain
7	PF04564 U-box	5.3e+02	12.2	U-box domain
8	PF00643 zf-B_box	1.8e-06	39.3	B-box zinc finger
9	PF00097 zf-C3HC4	0.012	26.8	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	7.4	17.8	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	0.0014	29.7	Zinc finger, C3HC4 type (RING finger)
12	PF15227 zf-C3HC4_4	0.0089	27.4	zinc finger of C3HC4-type, RING
13	PF13639 zf-RING_2	0.2	23.4	Ring finger domain
14	PF14634 zf-RING_5	2.5	19.4	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	0.00032	32.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011364

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007925	0.936	Immunoglobulin (CD79A) binding protein 1
2	60711.ENSCSAP00000003550	0.795	Ubiquitin-conjugating enzyme E2D 1
3	60711.ENSCSAP00000005283	0.782	Midline 2
4	60711.ENSCSAP00000011484	0.656	Anosmin 1
5	60711.ENSCSAP00000007447	0.651	Calpain 14
6	60711.ENSCSAP00000001521	0.632	Gamma-butyrobetaine hydroxylase 1
7	60711.ENSCSAP00000000252	0.602	THAP domain containing 12
8	60711.ENSCSAP00000002690	0.576	T cell receptor associated transmembrane adaptor 1
9	60711.ENSCSAP00000009789	0.567	Protein phosphatase 2, catalytic subunit, alpha isozyme
10	60711.ENSCSAP00000010671	0.528	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
11	60711.ENSCSAP00000010236	0.509	Promyelocytic leukemia

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0042802	0.883	identical protein binding
GO:0003824	0.850	catalytic activity
GO:0140096	0.832	catalytic activity, acting on a protein
GO:0016740	0.776	transferase activity
GO:0003713	0.525	transcription coactivator activity
GO:0019899	0.495	enzyme binding
GO:0019787	0.411	ubiquitin-like protein transferase activity
GO:0004842	0.365	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.991	cellular process
GO:0048583	0.990	regulation of response to stimulus
GO:0010646	0.989	regulation of cell communication
GO:0048518	0.982	positive regulation of biological process
GO:0023051	0.978	regulation of signaling
GO:0009966	0.972	regulation of signal transduction
GO:0044380	0.971	protein localization to cytoskeleton
GO:0048522	0.957	positive regulation of cellular process
GO:1902531	0.890	regulation of intracellular signal transduction
GO:0048519	0.870	negative regulation of biological process
GO:0072698	0.793	protein localization to microtubule cytoskeleton
GO:1902533	0.788	positive regulation of intracellular signal transduction
GO:0019222	0.782	regulation of metabolic process
GO:0031323	0.720	regulation of cellular metabolic process
GO:0060255	0.696	regulation of macromolecule metabolic process
GO:0080090	0.601	regulation of primary metabolic process
GO:0051171	0.601	regulation of nitrogen compound metabolic process
GO:0008152	0.567	metabolic process
GO:0071704	0.544	organic substance metabolic process
GO:0050896	0.507	response to stimulus
GO:0048523	0.502	negative regulation of cellular process
GO:0065009	0.463	regulation of molecular function
GO:0010468	0.462	regulation of gene expression
GO:0006807	0.455	nitrogen compound metabolic process
GO:0007017	0.440	microtubule-based process
GO:0009893	0.384	positive regulation of metabolic process
GO:1901564	0.338	organonitrogen compound metabolic process
GO:0019219	0.326	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.324	primary metabolic process
GO:0071840	0.322	cellular component organization or biogenesis
GO:0051252	0.319	regulation of RNA metabolic process
GO:0031326	0.315	regulation of cellular biosynthetic process
GO:0006355	0.311	regulation of DNA-templated transcription
GO:0043170	0.308	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0005856	0.988	cytoskeleton
GO:0015630	0.977	microtubule cytoskeleton
GO:0043233	0.750	organelle lumen
GO:0070013	0.741	intracellular organelle lumen
GO:0005634	0.687	nucleus
GO:0032991	0.586	protein-containing complex
GO:0005815	0.467	microtubule organizing center
GO:0034451	0.430	centriolar satellite
GO:1903561	0.383	extracellular vesicle
GO:0005794	0.361	Golgi apparatus
GO:0005615	0.322	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.776	Transferases.

[back to server]