StarFunc result for job id O15347

User Input

>input (200 residues)
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40618	0.815	0.807	4.895E-25	202	0.925	0.916	P40618.pdb.gz	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3
2	AFDB:F1RJ01	0.416	0.398	1.017E-19	210	0.665	0.633	F1RJ01.pdb.gz	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
3	AFDB:P09429	0.446	0.418	1.515E-19	215	0.720	0.670	P09429.pdb.gz	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
4	AFDB:F2Z594	0.407	0.372	2.258E-19	220	0.660	0.600	F2Z594.pdb.gz	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
5	AFDB:Q6NX86	0.476	0.466	2.835E-19	205	0.635	0.620	Q6NX86.pdb.gz	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
6	AFDB:P07746	0.427	0.420	1.216E-17	204	0.585	0.574	P07746.pdb.gz	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
7	AFDB:X2JGB1	0.444	0.420	1.712E-17	212	0.585	0.552	X2JGB1.pdb.gz	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1
8	AFDB:Q24537	0.447	0.234	1.008E-14	393	0.455	0.232	Q24537.pdb.gz	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
9	AFDB:Q8WW32	0.417	0.447	1.696E-12	186	0.350	0.376	Q8WW32.pdb.gz	HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens OX=9606 GN=HMGB4 PE=1 SV=2
10	AFDB:P23497	0.397	0.095	1.901E-12	879	0.550	0.125	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
11	PDB:1j5nA	0.349	0.700	2.809E-4	93	0.190	0.409	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.232	0.105	1.395E-1	451	0.120	0.053	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:6zm7CE	0.191	0.303	7.273E-1	124	0.110	0.177	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:5mkkA	0.141	0.064	1.915	593	0.105	0.035	5mkkA.pdb.gz
15	PDB:4ye6A	0.125	0.043	2.146	709	0.050	0.014	4ye6A.pdb.gz
16	PDB:7aoaD	0.148	0.094	3.197	343	0.045	0.026	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
17	PDB:7n9sA	0.125	0.014	3.385	2365	0.080	0.007	7n9sA.pdb.gz
18	PDB:7b5lH	0.120	0.064	3.793	423	0.105	0.050	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
19	PDB:8ap8h	0.126	0.170	3.793	137	0.110	0.161	8ap8h.pdb.gz
20	PDB:7pj1B	0.148	0.232	4.015	122	0.090	0.148	7pj1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15347	2.20e-141	394	200	1.000	1.000	HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4
2	O54879	1.87e-138	386	200	0.975	0.975	HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus OX=10090 GN=Hmgb3 PE=1 SV=3
3	Q32L31	1.61e-137	384	200	0.975	0.975	HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus OX=9913 GN=HMGB3 PE=2 SV=2
4	P40618	1.51e-100	291	202	0.745	0.738	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3
5	Q9YH06	1.41e-84	251	215	0.655	0.609	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
6	F2Z594	2.41e-84	250	220	0.660	0.600	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
7	P09429	2.68e-84	250	215	0.660	0.614	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
8	P10103	2.68e-84	250	215	0.660	0.614	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
9	P63158	2.68e-84	250	215	0.660	0.614	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
10	P63159	2.68e-84	250	215	0.660	0.614	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
11	F1NPU8	3.75e-84	249	207	0.640	0.618	F1NPU8_CHICK High mobility group box 2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=1 SV=1
12	P12682	1.34e-83	248	215	0.655	0.609	HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
13	P26584	1.46e-83	248	207	0.640	0.618	HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2
14	Q5U071	1.60e-82	245	208	0.645	0.620	Q5U071_HUMAN High-mobility group box 2 OS=Homo sapiens OX=9606 PE=2 SV=1
15	P26583	1.65e-82	245	209	0.645	0.617	HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2
16	P40673	1.65e-82	245	209	0.645	0.617	HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3
17	Q6NX86	3.01e-82	244	205	0.645	0.629	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
18	P52925	5.75e-82	244	210	0.640	0.610	HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2
19	P30681	1.53e-80	240	210	0.635	0.605	HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3
20	Q3U566	1.53e-80	240	210	0.635	0.605	Q3U566_MOUSE HMG box domain-containing protein OS=Mus musculus OX=10090 GN=Hmgb2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08073 CHDNT	2.8e+02	12.8	CHDNT (NUC034) domain
2	PF19439 CLEC16A_C	2.4e+02	11.6	CLEC16A C-terminal
3	PF00505 HMG_box	5.7e-40	146.9	HMG (high mobility group) box
4	PF09011 HMG_box_2	2.7e-46	167.4	HMG-box domain
5	PF14887 HMG_box_5	0.33	22.3	HMG (high mobility group) box 5
6	PF00428 Ribosomal_60s	9.5e+02	11.8	60s Acidic ribosomal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010381292.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010362667.1	0.714	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
2	61622.XP_010354185.1	0.699	SPT16 homolog, facilitates chromatin remodeling subunit
3	61622.XP_010367340.1	0.662	INO80 complex subunit
4	61622.XP_010374483.1	0.639	Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize
5	61622.XP_010368284.1	0.631	DNA-directed RNA polymerase I subunit RPA49
6	61622.XP_010376432.1	0.624	Advanced glycosylation end product-specific receptor isoform X1
7	61622.XP_010354947.1	0.610	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
8	61622.XP_010366915.1	0.593	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
9	61622.XP_010353655.1	0.591	Belongs to the actin family.
10	61622.XP_010363327.1	0.585	WD repeat domain 82
11	61622.XP_010386815.1	0.572	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
12	61622.XP_010368133.1	0.571	Belongs to the SNF5 family.
13	61622.XP_010373244.1	0.560	DNA-directed RNA polymerase, mitochondrial isoform X1
14	61622.XP_010372176.1	0.551	Belongs to the actin family.
15	61622.XP_010376030.1	0.551	Belongs to the actin family.
16	61622.XP_010355993.1	0.546	AT-rich interactive domain-containing protein 4A isoform X1
17	61622.XP_010382951.1	0.546	AT-rich interactive domain-containing protein 4B isoform X1
18	61622.XP_010361005.1	0.529	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 45 ESTs, 2 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments
19	61622.XP_010372033.1	0.527	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
20	61622.XP_010362714.1	0.525	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008301	0.998	DNA binding, bending
GO:0005515	0.976	protein binding
GO:0003690	0.882	double-stranded DNA binding
GO:0003723	0.633	RNA binding
GO:0000400	0.494	four-way junction DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0016043	0.977	cellular component organization
GO:0050789	0.959	regulation of biological process
GO:0050794	0.930	regulation of cellular process
GO:0071704	0.902	organic substance metabolic process
GO:0044238	0.888	primary metabolic process
GO:0019222	0.860	regulation of metabolic process
GO:0044237	0.859	cellular metabolic process
GO:0006807	0.835	nitrogen compound metabolic process
GO:0048518	0.826	positive regulation of biological process
GO:0060255	0.805	regulation of macromolecule metabolic process
GO:0050896	0.797	response to stimulus
GO:0043170	0.790	macromolecule metabolic process
GO:0006259	0.784	DNA metabolic process
GO:0051276	0.714	chromosome organization
GO:0080090	0.635	regulation of primary metabolic process
GO:0051171	0.635	regulation of nitrogen compound metabolic process
GO:0010468	0.614	regulation of gene expression
GO:0048522	0.564	positive regulation of cellular process
GO:0031323	0.555	regulation of cellular metabolic process
GO:0009893	0.499	positive regulation of metabolic process
GO:0010604	0.488	positive regulation of macromolecule metabolic process
GO:0019219	0.460	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.371	regulation of biosynthetic process
GO:0051252	0.371	regulation of RNA metabolic process
GO:2001141	0.363	regulation of RNA biosynthetic process
GO:0006355	0.353	regulation of DNA-templated transcription
GO:0051173	0.352	positive regulation of nitrogen compound metabolic process
GO:0031325	0.329	positive regulation of cellular metabolic process
GO:0006950	0.326	response to stress
GO:0048519	0.314	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0070013	0.930	intracellular organelle lumen
GO:0031981	0.883	nuclear lumen
GO:0000785	0.847	chromatin
GO:0005654	0.836	nucleoplasm
GO:0005737	0.734	cytoplasm
GO:0005576	0.378	extracellular region
GO:0032991	0.309	protein-containing complex
GO:0016020	0.304	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]