StarFunc result for job id O15350

User Input

>input (636 residues)
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AA88	0.505	0.473	6.088E-98	684	0.903	0.839	D4AA88.pdb.gz	D4AA88_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
2	AFDB:B0S576	0.529	0.526	1.147E-83	640	0.715	0.711	B0S576.pdb.gz	B0S576_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
3	AFDB:A0A0S2Z4N5	0.375	0.352	8.598E-67	680	0.564	0.528	A0A0S2Z4N5.pdb.gz	A0A0S2Z4N5_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
4	AFDB:E9QG65	0.466	0.469	1.419E-64	632	0.538	0.541	E9QG65.pdb.gz
5	AFDB:P25035	0.340	0.540	1.687E-42	396	0.289	0.465	P25035.pdb.gz	P53_ONCMY Cellular tumor antigen p53 OS=Oncorhynchus mykiss OX=8022 GN=tp53 PE=2 SV=1
6	AFDB:P10360	0.324	0.552	2.954E-40	367	0.264	0.458	P10360.pdb.gz	P53_CHICK Cellular tumor antigen p53 OS=Gallus gallus OX=9031 GN=TP53 PE=1 SV=1
7	AFDB:Q29537	0.358	0.582	8.013E-40	381	0.259	0.433	Q29537.pdb.gz	P53_CANLF Cellular tumor antigen p53 OS=Canis lupus familiaris OX=9615 GN=TP53 PE=2 SV=2
8	AFDB:G1K2L5	0.331	0.559	2.305E-39	374	0.248	0.422	G1K2L5.pdb.gz	G1K2L5_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=brp53 PE=1 SV=1
9	AFDB:F1SY23	0.316	0.513	2.592E-39	386	0.258	0.425	F1SY23.pdb.gz	F1SY23_BOVIN Cellular tumor antigen p53 OS=Bos taurus OX=9913 GN=TP53 PE=2 SV=1
10	AFDB:K7PPA8	0.317	0.507	4.943E-39	393	0.250	0.405	K7PPA8.pdb.gz	K7PPA8_HUMAN Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53 PE=2 SV=1
11	PDB:6xreM	0.240	0.441	2.677E-21	314	0.215	0.436	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
12	PDB:4n20A	0.124	0.123	5.696E-3	639	0.041	0.041	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
13	PDB:1q90A	0.137	0.247	9.661E-3	292	0.035	0.075	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
14	PDB:6drvA	0.121	0.080	9.661E-3	1024	0.019	0.012	6drvA.pdb.gz
15	PDB:5ir3A	0.099	0.408	1.296E-2	111	0.027	0.153	5ir3A.pdb.gz
16	PDB:3oaiA	0.101	0.129	1.457E-2	488	0.024	0.031	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
17	PDB:7u05B	0.106	0.086	1.457E-2	815	0.017	0.013	7u05B.pdb.gz
18	PDB:4f38B	0.141	0.376	1.638E-2	192	0.039	0.130	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
19	PDB:4nenA	0.145	0.092	1.638E-2	1063	0.022	0.013	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
20	PDB:1cd0A	0.085	0.309	2.072E-2	111	0.024	0.135	1cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4N5	0.0	663	680	0.571	0.534	A0A0S2Z4N5_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
2	A0A0S2Z4N6	0.0	655	676	0.569	0.536	A0A0S2Z4N6_HUMAN Tumor protein 63 (p63) (Fragment) OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
3	A0A8I5ZJF2	0.0	656	494	0.489	0.630	A0A8I5ZJF2_RAT Cellular tumor antigen p53 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
4	A0A8I6ADJ7	0.0	822	452	0.631	0.887	A0A8I6ADJ7_RAT Cellular tumor antigen p53 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
5	A0A8I6APF4	0.0	1084	590	0.835	0.900	A0A8I6APF4_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
6	B0S576	0.0	904	640	0.719	0.714	B0S576_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
7	B0S577	0.0	674	555	0.564	0.647	B0S577_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=TAp73 PE=3 SV=1
8	D4AA88	0.0	1169	684	0.895	0.832	D4AA88_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
9	F1NWD0	0.0	646	586	0.538	0.584	F1NWD0_CHICK Tumor protein 63 (p63) OS=Gallus gallus OX=9031 GN=TP63 PE=2 SV=2
10	O15350	0.0	1325	636	1.000	1.000	P73_HUMAN Tumor protein p73 OS=Homo sapiens OX=9606 GN=TP73 PE=1 SV=1
11	O88898	0.0	663	680	0.569	0.532	P63_MOUSE Tumor protein 63 OS=Mus musculus OX=10090 GN=Tp63 PE=1 SV=1
12	Q801Z7	0.0	902	640	0.717	0.713	Q801Z7_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=sb:eu652 PE=2 SV=1
13	Q8JFE3	0.0	606	576	0.517	0.571	Q8JFE3_DANRE Tumor protein 63 (p63) (Fragment) OS=Danio rerio OX=7955 GN=wu:fc89f04 PE=1 SV=1
14	Q8JHZ6	0.0	604	588	0.517	0.560	Q8JHZ6_DANRE Tumor protein 63 (p63) OS=Danio rerio OX=7955 GN=fc89f04 PE=1 SV=1
15	Q9DEC7	0.0	634	582	0.535	0.584	Q9DEC7_CHICK Tumor protein 63 (p63) OS=Gallus gallus OX=9031 GN=dNp63a PE=2 SV=1
16	Q9H3D4	0.0	663	680	0.571	0.534	P63_HUMAN Tumor protein 63 OS=Homo sapiens OX=9606 GN=TP63 PE=1 SV=1
17	Q9JJP2	0.0	1154	631	0.887	0.894	P73_MOUSE Tumor protein p73 OS=Mus musculus OX=10090 GN=Tp73 PE=1 SV=1
18	Q9JJP6	0.0	663	680	0.569	0.532	P63_RAT Tumor protein 63 OS=Rattus norvegicus OX=10116 GN=Tp63 PE=2 SV=1
19	C9D7D0	1.47e-173	501	416	0.407	0.623	C9D7D0_HUMAN Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP63 PE=2 SV=1
20	Q8JHZ5	5.64e-166	484	457	0.418	0.582	Q8JHZ5_DANRE Cellular tumor antigen p53 OS=Danio rerio OX=7955 GN=tp73l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00870 P53	7.4e-59	210.4	P53 DNA-binding domain
2	PF07710 P53_tetramer	1.8e-15	67.3	P53 tetramerisation motif
3	PF00536 SAM_1	1.4	20.7	SAM domain (Sterile alpha motif)
4	PF07647 SAM_2	2e-06	39.1	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.999	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000478927	0.998	Transcriptional coactivator YAP1
3	9606.ENSP00000263253	0.995	Histone acetyltransferase p300
4	9606.ENSP00000361423	0.989	Tyrosine-protein kinase ABL1
5	9606.ENSP00000480499	0.987	E3 ubiquitin-protein ligase Itchy homolog
6	9606.ENSP00000457230	0.985	WW domain-containing oxidoreductase
7	9606.ENSP00000479618	0.966	Myc proto-oncogene protein
8	9606.ENSP00000267163	0.962	Retinoblastoma-associated protein
9	9606.ENSP00000272317	0.960	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000269305	0.958	Cellular tumor antigen p53
11	9606.ENSP00000212015	0.957	NAD-dependent protein deacetylase sirtuin-1
12	9606.ENSP00000266970	0.957	Cyclin-dependent kinase 2
13	9606.ENSP00000341957	0.957	Apoptosis-stimulating of p53 protein 2
14	9606.ENSP00000378699	0.957	Cyclin-dependent kinase 1
15	9606.ENSP00000247970	0.955	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
16	9606.ENSP00000262643	0.955	G1/S-specific cyclin-E1
17	9606.ENSP00000302530	0.952	Mitotic checkpoint serine/threonine-protein kinase BUB1
18	9606.ENSP00000331327	0.947	Wilms tumor protein
19	9606.ENSP00000310332	0.940	F-box/SPRY domain-containing protein 1
20	9606.ENSP00000274026	0.939	Cyclin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0140110	0.969	transcription regulator activity
GO:0005515	0.960	protein binding
GO:0003700	0.956	DNA-binding transcription factor activity
GO:0043565	0.912	sequence-specific DNA binding
GO:0042802	0.607	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0050896	0.980	response to stimulus
GO:0009987	0.966	cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0019222	0.965	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0048523	0.957	negative regulation of cellular process
GO:0010941	0.954	regulation of cell death
GO:0010942	0.937	positive regulation of cell death
GO:0043068	0.934	positive regulation of programmed cell death
GO:0031323	0.932	regulation of cellular metabolic process
GO:0032502	0.920	developmental process
GO:0051716	0.913	cellular response to stimulus
GO:0043065	0.890	positive regulation of apoptotic process
GO:0048583	0.882	regulation of response to stimulus
GO:0023051	0.881	regulation of signaling
GO:0010646	0.880	regulation of cell communication
GO:0009966	0.868	regulation of signal transduction
GO:0032501	0.866	multicellular organismal process
GO:0048856	0.863	anatomical structure development
GO:0009967	0.843	positive regulation of signal transduction
GO:0009889	0.839	regulation of biosynthetic process
GO:0019219	0.837	regulation of nucleobase-containing compound metabolic process
GO:0007165	0.831	signal transduction
GO:1902533	0.827	positive regulation of intracellular signal transduction
GO:0006950	0.808	response to stress
GO:0050793	0.807	regulation of developmental process
GO:0008152	0.805	metabolic process
GO:0033554	0.792	cellular response to stress
GO:0071704	0.779	organic substance metabolic process
GO:0035556	0.751	intracellular signal transduction
GO:0051239	0.738	regulation of multicellular organismal process
GO:0010468	0.736	regulation of gene expression
GO:0006807	0.735	nitrogen compound metabolic process
GO:0042221	0.722	response to chemical
GO:0006355	0.719	regulation of DNA-templated transcription
GO:0044238	0.715	primary metabolic process
GO:0048513	0.714	animal organ development
GO:0007275	0.679	multicellular organism development
GO:0006915	0.630	apoptotic process
GO:0097190	0.600	apoptotic signaling pathway
GO:0043170	0.587	macromolecule metabolic process
GO:0044237	0.566	cellular metabolic process
GO:0010033	0.561	response to organic substance
GO:0097193	0.554	intrinsic apoptotic signaling pathway
GO:0048731	0.537	system development
GO:0045687	0.525	positive regulation of glial cell differentiation
GO:0071840	0.517	cellular component organization or biogenesis
GO:0016043	0.504	cellular component organization
GO:0009893	0.491	positive regulation of metabolic process
GO:0010604	0.470	positive regulation of macromolecule metabolic process
GO:0051173	0.452	positive regulation of nitrogen compound metabolic process
GO:0031325	0.442	positive regulation of cellular metabolic process
GO:0051093	0.425	negative regulation of developmental process
GO:0010605	0.424	negative regulation of macromolecule metabolic process
GO:0006974	0.411	cellular response to DNA damage stimulus
GO:0031324	0.392	negative regulation of cellular metabolic process
GO:0045665	0.384	negative regulation of neuron differentiation
GO:0043410	0.365	positive regulation of MAPK cascade
GO:0048713	0.348	regulation of oligodendrocyte differentiation
GO:0051172	0.338	negative regulation of nitrogen compound metabolic process
GO:0072331	0.330	signal transduction by p53 class mediator

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005737	0.984	cytoplasm
GO:0005654	0.953	nucleoplasm
GO:0032991	0.944	protein-containing complex
GO:0005829	0.943	cytosol
GO:0012505	0.514	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]