StarFunc result for job id O15353

User Input

>input (648 residues)
MVSLPPPQSDVTLPGPTRLEGERQGDLMQAPGLPGSPAPQSKHAGFSCSSFVSDGPPERT
PSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSH
APFHPYKRPFHEDVFPEAETTLALKGHSFKTPGPLEAFEEIPVDVAEAEAFLPGFSAEAW
CNGLPYPSQEHGPQVLGSEVKVKPPVLESGAGMFCYQPPLQHMYCSSQPPFHQYSPGGGS
YPIPYLGSSHYQYQRMAPQASTDGHQPLFPKPIYSYSILIFMALKNSKTGSLPVSEIYNF
MTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKSGSSSRKGCLWALNPAKIDKMQEEL
QKWKRKDPIAVRKSMAKPEELDSLIGDKREKLGSPLLGCPPPGLSGSGPIRPLAPPAGLS
PPLHSLHPAPGPIPGKNPLQDLLMGHTPSCYGQTYLHLSPGLAPPGPPQPLFPQPDGHLE
LRAQPGTPQDSPLPAHTPPSHSAKLLAEPSPARTMHDTLLPDGDLGTDLDAINPSLTDFD
FQGNLWEQLKDDSLALDPLVLVTSSPTSSSMPPPQPPPHCFPPGPCLTETGSGAGDLAAP
GSGGSGALGDLHLTTLYSAFMELEPTPPTAPAGPSVYLSPSSKPVALA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15353	0.999	0.999	8.176E-87	648	1.000	1.000	O15353.pdb.gz	FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens OX=9606 GN=FOXN1 PE=1 SV=1
2	AFDB:D4A1T1	0.282	0.358	3.371E-57	474	0.623	0.852	D4A1T1.pdb.gz	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
3	AFDB:Q8K3Q3	0.201	0.248	2.940E-25	521	0.307	0.382	Q8K3Q3.pdb.gz	FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus OX=10090 GN=Foxn4 PE=1 SV=1
4	AFDB:A2BGM5	0.191	0.225	7.993E-25	550	0.309	0.364	A2BGM5.pdb.gz	FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio OX=7955 GN=foxn4 PE=1 SV=1
5	AFDB:Q6P0C9	0.154	0.224	6.306E-10	427	0.148	0.225	Q6P0C9.pdb.gz	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
6	AFDB:Q12946	0.145	0.242	1.512E-8	379	0.154	0.264	Q12946.pdb.gz	FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens OX=9606 GN=FOXF1 PE=1 SV=2
7	AFDB:O43058	0.141	0.138	2.547E-7	663	0.170	0.166	O43058.pdb.gz	SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sep1 PE=1 SV=1
8	PDB:2hdcA	0.119	0.615	1.217E-5	97	0.057	0.381	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
9	AFDB:O43524	0.114	0.110	2.638E-4	673	0.164	0.158	O43524.pdb.gz	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
10	AFDB:F1NNE8	0.117	0.115	2.798E-4	660	0.165	0.162	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
11	AFDB:A4L7N3	0.118	0.116	3.725E-3	662	0.167	0.163	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
12	PDB:2nyxB	0.114	0.435	6.545E-2	147	0.022	0.095	2nyxB.pdb.gz
13	PDB:5h3rA	0.108	0.405	6.545E-2	141	0.019	0.085	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
14	PDB:7jgrD	0.119	0.168	6.941E-2	441	0.020	0.029	7jgrD.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
15	PDB:5k1yD	0.101	0.576	9.880E-2	92	0.026	0.185	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
16	PDB:6fail	0.104	0.222	1.111E-1	286	0.015	0.035	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
17	PDB:6yxyBi	0.113	0.332	1.779E-1	192	0.015	0.052	6yxyBi.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:4zzlA	0.108	0.397	1.887E-1	146	0.019	0.082	4zzlA.pdb.gz
19	PDB:5hs7A	0.110	0.552	1.887E-1	102	0.020	0.127	5hs7A.pdb.gz
20	PDB:6g18v	0.100	0.186	1.887E-1	325	0.025	0.049	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GMI6	0.0	1084	648	0.855	0.855	A0A8I6GMI6_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=1
2	D4A1T1	0.0	1078	660	0.853	0.838	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
3	O15353	0.0	1285	648	1.000	1.000	FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens OX=9606 GN=FOXN1 PE=1 SV=1
4	Q61575	0.0	1088	648	0.861	0.861	FOXN1_MOUSE Forkhead box protein N1 OS=Mus musculus OX=10090 GN=Foxn1 PE=1 SV=1
5	F1R9K2	2.05e-106	335	565	0.306	0.350	F1R9K2_DANRE Forkhead box N1 OS=Danio rerio OX=7955 GN=nude PE=4 SV=1
6	Q7ZTC0	3.89e-106	334	565	0.306	0.350	Q7ZTC0_DANRE Forkhead box protein N1 OS=Danio rerio OX=7955 GN=whnb PE=2 SV=1
7	Q8K3Q3	1.61e-84	276	521	0.287	0.357	FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus OX=10090 GN=Foxn4 PE=1 SV=1
8	Q96NZ1	9.05e-81	266	517	0.281	0.352	FOXN4_HUMAN Forkhead box protein N4 OS=Homo sapiens OX=9606 GN=FOXN4 PE=1 SV=2
9	A2BGM5	1.84e-79	264	550	0.261	0.307	FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio OX=7955 GN=foxn4 PE=1 SV=1
10	Q9XTP7	4.35e-47	179	719	0.120	0.108	Q9XTP7_DROME DOMINA protein OS=Drosophila melanogaster OX=7227 GN=jumu PE=2 SV=1
11	Q499D0	8.73e-27	116	457	0.083	0.118	FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus OX=10090 GN=Foxn3 PE=1 SV=1
12	O00409	1.17e-26	116	490	0.083	0.110	FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3 PE=1 SV=1
13	Q8BSS2	1.23e-26	110	211	0.077	0.237	Q8BSS2_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=2 SV=1
14	P32314	1.15e-25	112	431	0.076	0.114	FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens OX=9606 GN=FOXN2 PE=1 SV=3
15	E9Q7L6	2.27e-25	111	429	0.077	0.117	E9Q7L6_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=1 SV=1
16	Q9U1H1	5.12e-25	102	120	0.077	0.417	Q9U1H1_DROME Checkpoint suppressor homologue (Fragment) OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=2 SV=1
17	M9PDZ5	6.58e-23	106	1267	0.077	0.039	M9PDZ5_DROME Checkpoint suppressor 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=1
18	Q9W3Q5	6.64e-23	106	1268	0.077	0.039	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
19	E9PYQ6	5.02e-22	96.7	208	0.066	0.207	E9PYQ6_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=4 SV=1
20	P32030	1.41e-19	92.4	322	0.080	0.161	SLP1_DROME Fork head domain transcription factor slp1 OS=Drosophila melanogaster OX=7227 GN=slp1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	3.5e-30	115.3	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226247

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243056	0.745	Homeobox protein Hox-C13
2	9606.ENSP00000368805	0.739	Chorion-specific transcription factor GCMb
3	9606.ENSP00000319104	0.729	Transcription elongation factor SPT6
4	9606.ENSP00000386212	0.701	Proteasome subunit beta type-11
5	9606.ENSP00000299440	0.665	V(D)J recombination-activating protein 1
6	9606.ENSP00000291582	0.654	Autoimmune regulator
7	9606.ENSP00000380379	0.651	Protein Wnt-5b
8	9606.ENSP00000286201	0.643	Frizzled-7
9	9606.ENSP00000301061	0.616	Protein Wnt-10b
10	9606.ENSP00000375086	0.614	C-C motif chemokine 25
11	9606.ENSP00000363826	0.604	Frizzled-8
12	9606.ENSP00000225512	0.580	Proto-oncogene Wnt-3
13	9606.ENSP00000257901	0.571	Keratin, type II cuticular Hb5
14	9606.ENSP00000381499	0.570	Paired box protein Pax-1
15	9606.ENSP00000225899	0.567	Keratin, type I cuticular Ha2
16	9606.ENSP00000484411	0.566	Homeobox protein Hox-A3
17	9606.ENSP00000234091	0.560	DNA-binding protein inhibitor ID-2
18	9606.ENSP00000352785	0.557	Desmoglein-4
19	9606.ENSP00000249749	0.556	Delta-like protein 4
20	9606.ENSP00000257951	0.550	Keratin, type II cuticular Hb4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.921	double-stranded DNA binding
GO:1990837	0.902	sequence-specific double-stranded DNA binding
GO:0001216	0.797	DNA-binding transcription activator activity
GO:0001228	0.666	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001067	0.556	transcription regulatory region nucleic acid binding
GO:0000976	0.553	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.998	anatomical structure development
GO:0032501	0.997	multicellular organismal process
GO:0009987	0.993	cellular process
GO:0065007	0.988	biological regulation
GO:0050789	0.984	regulation of biological process
GO:0007275	0.977	multicellular organism development
GO:0002376	0.971	immune system process
GO:0050794	0.968	regulation of cellular process
GO:0030154	0.968	cell differentiation
GO:0048513	0.962	animal organ development
GO:0048731	0.958	system development
GO:0008544	0.948	epidermis development
GO:0030855	0.933	epithelial cell differentiation
GO:0043588	0.932	skin development
GO:0060255	0.927	regulation of macromolecule metabolic process
GO:0048518	0.906	positive regulation of biological process
GO:0010468	0.880	regulation of gene expression
GO:0051171	0.879	regulation of nitrogen compound metabolic process
GO:0080090	0.875	regulation of primary metabolic process
GO:0031323	0.875	regulation of cellular metabolic process
GO:0019219	0.873	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.858	regulation of DNA-templated transcription
GO:0048522	0.844	positive regulation of cellular process
GO:0048534	0.837	hematopoietic or lymphoid organ development
GO:0009913	0.836	epidermal cell differentiation
GO:0030216	0.816	keratinocyte differentiation
GO:0048538	0.754	thymus development
GO:0050896	0.716	response to stimulus
GO:0006357	0.608	regulation of transcription by RNA polymerase II
GO:0009653	0.535	anatomical structure morphogenesis
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0051173	0.424	positive regulation of nitrogen compound metabolic process
GO:0031325	0.420	positive regulation of cellular metabolic process
GO:0045935	0.365	positive regulation of nucleobase-containing compound metabolic process
GO:0051239	0.359	regulation of multicellular organismal process
GO:0050793	0.358	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.326	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]