StarFunc result for job id O15354

User Input

>input (613 residues)
MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15354	1.000	1.000	1.286E-72	613	1.000	1.000	O15354.pdb.gz	GPR37_HUMAN Prosaposin receptor GPR37 OS=Homo sapiens OX=9606 GN=GPR37 PE=1 SV=2
2	AFDB:Q9QY42	0.660	0.673	1.302E-58	600	0.817	0.835	Q9QY42.pdb.gz	GPR37_MOUSE Prosaposin receptor GPR37 OS=Mus musculus OX=10090 GN=Gpr37 PE=2 SV=1
3	PDB:7x9cR	0.419	0.799	6.382E-11	302	0.096	0.195	7x9cR.pdb.gz
4	PDB:5zbqA	0.397	0.516	1.041E-10	463	0.104	0.138	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor
5	PDB:5glhA	0.383	0.513	1.421E-10	452	0.127	0.173	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
6	PDB:7wq3R	0.408	0.816	1.698E-10	289	0.103	0.218	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
7	PDB:7sqoR	0.364	0.760	2.649E-10	270	0.091	0.207	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
8	PDB:7mbyR	0.408	0.833	2.770E-10	283	0.093	0.201	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
9	PDB:7rmgR	0.407	0.813	2.896E-10	289	0.098	0.208	7rmgR.pdb.gz	Selective G protein signaling driven by substance P-neurokinin receptor dynamics.
10	PDB:7x9bR	0.406	0.777	3.617E-10	302	0.096	0.195	7x9bR.pdb.gz
11	PDB:7w55R	0.407	0.772	4.134E-10	303	0.088	0.178	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
12	PDB:8ef5M	0.406	0.811	4.322E-10	288	0.101	0.215	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
13	AFDB:Q13585	0.408	0.406	7.182E-5	617	0.106	0.105	Q13585.pdb.gz	MTR1L_HUMAN Melatonin-related receptor OS=Homo sapiens OX=9606 GN=GPR50 PE=1 SV=3
14	AFDB:O94294	0.107	0.081	3.802E-2	886	0.135	0.094	O94294.pdb.gz	SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sog2 PE=1 SV=1
15	AFDB:Q8NEC5	0.079	0.068	9.256E-2	780	0.145	0.114	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3
16	AFDB:Q91ZR5	0.111	0.103	2.463E-1	686	0.109	0.098	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
17	AFDB:Q6FWS6	0.076	0.073	5.246E-1	652	0.116	0.109	Q6FWS6.pdb.gz	Q6FWS6_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=FPS1 PE=4 SV=1
18	AFDB:Q0DRX6	0.107	0.081	5.484E-1	902	0.117	0.080	Q0DRX6.pdb.gz	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
19	AFDB:Q4GYI9	0.093	0.040	8.946E-1	1737	0.160	0.056	Q4GYI9.pdb.gz	Q4GYI9_TRYB2 Fusaric acid resistance protein-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3880 PE=4 SV=1
20	AFDB:Q9W3K6	0.086	0.072	1.168	801	0.119	0.091	Q9W3K6.pdb.gz	Q9W3K6_DROME LD35927p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2258 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15354	0.0	1259	613	1.000	1.000	GPR37_HUMAN Prosaposin receptor GPR37 OS=Homo sapiens OX=9606 GN=GPR37 PE=1 SV=2
2	Q9QY42	0.0	950	600	0.817	0.835	GPR37_MOUSE Prosaposin receptor GPR37 OS=Mus musculus OX=10090 GN=Gpr37 PE=2 SV=1
3	O60883	3.74e-129	390	481	0.333	0.424	G37L1_HUMAN G-protein coupled receptor 37-like 1 OS=Homo sapiens OX=9606 GN=GPR37L1 PE=1 SV=2
4	Q99JG2	4.27e-127	384	481	0.321	0.410	G37L1_MOUSE G-protein coupled receptor 37-like 1 OS=Mus musculus OX=10090 GN=Gpr37l1 PE=1 SV=2
5	P21451	5.52e-33	134	442	0.155	0.215	EDNRB_RAT Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2
6	P48302	1.27e-32	132	442	0.152	0.210	EDNRB_MOUSE Endothelin receptor type B OS=Mus musculus OX=10090 GN=Ednrb PE=2 SV=1
7	B3DLG5	1.74e-32	132	422	0.166	0.242	B3DLG5_DANRE Endothelin-1 receptor OS=Danio rerio OX=7955 GN=ednra PE=2 SV=1
8	P24530	3.93e-32	131	442	0.165	0.229	EDNRB_HUMAN Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1
9	Q9DGM2	8.06e-29	121	426	0.160	0.230	Q9DGM2_DANRE Endothelin receptor type B OS=Danio rerio OX=7955 GN=ednrb1 PE=2 SV=1
10	P52500	3.79e-25	110	384	0.152	0.242	GRPR_RAT Gastrin-releasing peptide receptor OS=Rattus norvegicus OX=10116 GN=Grpr PE=1 SV=2
11	P26684	4.85e-25	110	426	0.126	0.181	EDNRA_RAT Endothelin-1 receptor OS=Rattus norvegicus OX=10116 GN=Ednra PE=2 SV=2
12	Q61614	4.95e-25	110	427	0.126	0.180	EDNRA_MOUSE Endothelin-1 receptor OS=Mus musculus OX=10090 GN=Ednra PE=2 SV=3
13	P24053	6.45e-25	109	390	0.147	0.231	NMBR_RAT Neuromedin-B receptor OS=Rattus norvegicus OX=10116 GN=Nmbr PE=2 SV=1
14	P25101	1.01e-24	109	427	0.126	0.180	EDNRA_HUMAN Endothelin-1 receptor OS=Homo sapiens OX=9606 GN=EDNRA PE=1 SV=1
15	P21729	1.23e-24	108	384	0.160	0.255	GRPR_MOUSE Gastrin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Grpr PE=1 SV=2
16	P28336	7.03e-24	106	390	0.153	0.241	NMBR_HUMAN Neuromedin-B receptor OS=Homo sapiens OX=9606 GN=NMBR PE=1 SV=2
17	Q8K418	4.07e-22	101	399	0.132	0.203	BRS3_RAT Bombesin receptor subtype-3 OS=Rattus norvegicus OX=10116 GN=Brs3 PE=2 SV=1
18	O54799	5.77e-22	100	390	0.132	0.208	NMBR_MOUSE Neuromedin-B receptor OS=Mus musculus OX=10090 GN=Nmbr PE=1 SV=1
19	P32247	2.53e-21	99.0	399	0.132	0.203	BRS3_HUMAN Bombesin receptor subtype-3 OS=Homo sapiens OX=9606 GN=BRS3 PE=1 SV=1
20	Q8IN35	9.52e-21	99.0	758	0.142	0.115	SIFAR_DROME Neuropeptide SIFamide receptor OS=Drosophila melanogaster OX=7227 GN=SIFaR PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.8e-26	102.9	7 transmembrane receptor (rhodopsin family)
2	PF00115 COX1	20	15.5	Cytochrome C and Quinol oxidase polypeptide I

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306449

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355865	0.998	E3 ubiquitin-protein ligase parkin
2	9606.ENSP00000378394	0.979	Prosaposin
3	9606.ENSP00000380178	0.924	Ubiquitin-conjugating enzyme E2 G1
4	9606.ENSP00000338348	0.913	Ubiquitin-conjugating enzyme E2 G2
5	9606.ENSP00000302961	0.840	Heat shock protein family A member 4
6	9606.ENSP00000261368	0.760	Synphilin-1
7	9606.ENSP00000366395	0.758	E3 ubiquitin-protein ligase synoviolin
8	9606.ENSP00000037243	0.754	Gamma-aminobutyric acid receptor-associated protein-like 2
9	9606.ENSP00000391311	0.726	Septin-5
10	9606.ENSP00000256857	0.725	Gastrin-releasing peptide
11	9606.ENSP00000354481	0.701	BMP/retinoic acid-inducible neural-specific protein 2
12	9606.ENSP00000219548	0.679	E3 ubiquitin-protein ligase CHIP
13	9606.ENSP00000413496	0.662	Fibroblast growth factor 12
14	9606.ENSP00000356641	0.653	E3 ubiquitin-protein ligase RFWD2
15	9606.ENSP00000270349	0.633	Sodium-dependent dopamine transporter
16	9606.ENSP00000327417	0.619	G-protein coupled receptor 39
17	9606.ENSP00000388825	0.619	Promotilin
18	9606.ENSP00000338345	0.614	Alpha-synuclein
19	9606.ENSP00000442982	0.606	Uracil nucleotide/cysteinyl leukotriene receptor
20	9606.ENSP00000385205	0.604	PRKCA-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008528	0.995	G protein-coupled peptide receptor activity
GO:0008188	0.879	neuropeptide receptor activity
GO:0019899	0.814	enzyme binding
GO:0044389	0.659	ubiquitin-like protein ligase binding
GO:0042277	0.638	peptide binding
GO:0031625	0.596	ubiquitin protein ligase binding
GO:0031072	0.548	heat shock protein binding
GO:0042923	0.499	neuropeptide binding
GO:0030544	0.493	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.998	cellular process
GO:0050896	0.990	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0023051	0.972	regulation of signaling
GO:0010646	0.971	regulation of cell communication
GO:0048583	0.964	regulation of response to stimulus
GO:0051716	0.951	cellular response to stimulus
GO:0009966	0.921	regulation of signal transduction
GO:0007154	0.919	cell communication
GO:0023052	0.913	signaling
GO:0007186	0.901	G protein-coupled receptor signaling pathway
GO:1902531	0.899	regulation of intracellular signal transduction
GO:0023056	0.892	positive regulation of signaling
GO:0048584	0.889	positive regulation of response to stimulus
GO:0009967	0.860	positive regulation of signal transduction
GO:1902533	0.778	positive regulation of intracellular signal transduction
GO:0043408	0.737	regulation of MAPK cascade
GO:0043410	0.715	positive regulation of MAPK cascade
GO:0007188	0.524	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	0.470	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0008152	0.380	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0032991	0.987	protein-containing complex
GO:0043226	0.977	organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0005622	0.962	intracellular anatomical structure
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005737	0.945	cytoplasm
GO:0009986	0.828	cell surface
GO:1990234	0.340	transferase complex
GO:0140535	0.325	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]