StarFunc result for job id O15355

User Input

>input (546 residues)
MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYD
GHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGR
PTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEE
PGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEPGIPTGEAGPS
CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEE
AEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKAL
DMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA
LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL
DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKK
KKAKRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15355	1.000	1.000	9.080E-95	546	1.000	1.000	O15355.pdb.gz	PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1
2	AFDB:F1QJE5	0.647	0.657	1.770E-70	537	0.689	0.700	F1QJE5.pdb.gz	F1QJE5_DANRE Protein phosphatase 1G isoform X1 OS=Danio rerio OX=7955 GN=cb167 PE=1 SV=2
3	PDB:1a6qA	0.473	0.702	3.694E-24	363	0.207	0.311	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
4	PDB:4oicB	0.417	0.729	1.319E-17	305	0.174	0.311	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
5	PDB:4jndA	0.406	0.535	3.311E-14	408	0.130	0.174	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
6	PDB:7kprA	0.371	0.494	2.925E-12	403	0.134	0.181	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
7	PDB:5nzzD	0.398	0.554	5.778E-12	379	0.130	0.187	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
8	AFDB:O60346	0.270	0.090	1.063E-11	1717	0.090	0.029	O60346.pdb.gz	PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3
9	PDB:2pk0A	0.210	0.439	9.525E-10	247	0.070	0.154	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
10	PDB:6jkvA	0.208	0.464	3.208E-8	230	0.064	0.152	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
11	PDB:5d2uA	0.323	0.677	4.614E-7	240	0.101	0.229	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
12	AFDB:Q93V88	0.221	0.171	3.504E-6	724	0.110	0.083	Q93V88.pdb.gz	P2C62_ARATH Probable protein phosphatase 2C 62 OS=Arabidopsis thaliana OX=3702 GN=At4g33500 PE=2 SV=1
13	PDB:3w40A	0.152	0.382	3.724E-4	199	0.042	0.116	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
14	PDB:6z4eA	0.099	0.242	7.037E-1	207	0.016	0.043	6z4eA.pdb.gz
15	AFDB:Q9EPQ2	0.091	0.049	8.702E-1	1331	0.108	0.044	Q9EPQ2.pdb.gz	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
16	AFDB:Q6DN12	0.087	0.060	2.283	878	0.099	0.062	Q6DN12.pdb.gz	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
17	AFDB:Q9UUD0	0.066	0.070	2.557	501	0.097	0.106	Q9UUD0.pdb.gz	YNQA_SCHPO Uncharacterized protein C19C2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.10 PE=1 SV=1
18	AFDB:A0A0B4KFL3	0.060	0.057	2.864	605	0.064	0.058	A0A0B4KFL3.pdb.gz	A0A0B4KFL3_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=Kat60 PE=3 SV=1
19	AFDB:O75674	0.064	0.071	3.208	476	0.057	0.065	O75674.pdb.gz	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
20	AFDB:A8WHR3	0.085	0.122	3.803	345	0.077	0.122	A8WHR3.pdb.gz	YJU2_DANRE Splicing factor YJU2 OS=Danio rerio OX=7955 GN=yju2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QJE5	0.0	635	537	0.689	0.700	F1QJE5_DANRE Protein phosphatase 1G isoform X1 OS=Danio rerio OX=7955 GN=cb167 PE=1 SV=2
2	O15355	0.0	1109	546	1.000	1.000	PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1
3	Q61074	0.0	950	542	0.925	0.932	PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus OX=10090 GN=Ppm1g PE=1 SV=3
4	Q6IAU5	0.0	1109	546	1.000	1.000	Q6IAU5_HUMAN PPM1G protein OS=Homo sapiens OX=9606 GN=PPM1G PE=2 SV=1
5	Q7ZTW5	0.0	586	495	0.639	0.705	Q7ZTW5_DANRE Protein phosphatase 1G OS=Danio rerio OX=7955 GN=cb167 PE=1 SV=1
6	Q8K3W9	0.0	950	542	0.927	0.934	Q8K3W9_RAT Protein phosphatase 1G (Formerly 2C), magnesium-dependent, gamma isoform OS=Rattus norvegicus OX=10116 GN=Ppm1g PE=1 SV=1
7	O81716	1.81e-61	208	355	0.192	0.296	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
8	Q9SZ53	2.19e-60	205	357	0.196	0.300	P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana OX=3702 GN=At4g31860 PE=2 SV=1
9	P49596	2.71e-51	181	356	0.187	0.287	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
10	Q4WTH5	1.23e-50	181	429	0.167	0.212	Q4WTH5_ASPFU Protein phosphatase 2C, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G09280 PE=3 SV=1
11	Q09172	4.68e-48	172	370	0.165	0.243	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
12	Q09173	1.87e-46	169	414	0.168	0.222	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1
13	P34221	1.87e-41	157	468	0.163	0.190	PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC3 PE=1 SV=4
14	A0A1D8PRZ8	3.37e-40	155	583	0.154	0.144	A0A1D8PRZ8_CANAL Type 2C protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTC2 PE=3 SV=1
15	Q381U4	1.95e-38	148	429	0.150	0.191	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
16	Q38BA8	3.51e-38	144	293	0.139	0.259	Q38BA8_TRYB2 Protein phosphatase 2C-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2270 PE=4 SV=1
17	P39966	1.02e-37	147	464	0.148	0.175	PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC2 PE=1 SV=1
18	Q8IHY0	1.37e-36	147	924	0.132	0.078	Q8IHY0_PLAF7 Protein phosphatase PPM2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1138500 PE=3 SV=2
19	Q586U3	3.26e-35	136	319	0.154	0.263	Q586U3_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.55 PE=4 SV=1
20	Q5U386	1.65e-33	133	382	0.141	0.202	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	2.5e-71	251.9	Protein phosphatase 2C
2	PF13672 PP2C_2	31	15.6	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343535	0.946	Ubiquitin carboxyl-terminal hydrolase 7
2	9606.ENSP00000422626	0.836	La-related protein 7
3	9606.ENSP00000246548	0.802	SUMO-activating enzyme subunit 2
4	9606.ENSP00000304669	0.794	Catenin alpha-1
5	9606.ENSP00000361626	0.789	Nuclease-sensitive element-binding protein 1
6	9606.ENSP00000308546	0.750	7SK snRNA methylphosphate capping enzyme
7	9606.ENSP00000341779	0.736	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
8	9606.ENSP00000387046	0.735	Protein phosphatase, Mg2+/Mn2+ dependent 1M
9	9606.ENSP00000388806	0.717	Eukaryotic translation initiation factor 4B
10	9606.ENSP00000362110	0.701	Splicing factor 3A subunit 3
11	9606.ENSP00000434024	0.694	Histone H2AX
12	9606.ENSP00000295461	0.692	Magnesium transporter NIPA3
13	9606.ENSP00000358814	0.678	S-adenosylhomocysteine hydrolase-like protein 1
14	9606.ENSP00000329466	0.668	NAD-dependent protein deacetylase sirtuin-7
15	9606.ENSP00000362937	0.666	Regulator of chromosome condensation
16	9606.ENSP00000346634	0.661	Thyroid hormone receptor-associated protein 3
17	9606.ENSP00000369897	0.655	Cysteine--tRNA ligase, cytoplasmic
18	9606.ENSP00000371388	0.653	Sulfiredoxin-1
19	9606.ENSP00000299259	0.652	COP9 signalosome complex subunit 2
20	9606.ENSP00000384638	0.651	Catenin alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0036211	0.931	protein modification process
GO:0051726	0.833	regulation of cell cycle
GO:0006470	0.818	protein dephosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.400	protein-containing complex
GO:0005737	0.364	cytoplasm
GO:0005829	0.347	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]