StarFunc result for job id O15360

User Input

>input (1455 residues)
MSDSWVPNSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRLLRSHQDLNAL
LLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
VGQICTAPAETSHPVLLTVEQRKKLSSLLEFAQYLLAHSMFSRLSFCQELWKIQSSLLLE
AVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQ
MFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFG
VFSGHTLGSVISTDPLKRFFSHTLTQILTHSPVLKASDAVQMQREWSFARTHPLLTSLYR
RLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWVARLMAQAFE
SCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRGYHGCSKKALVFLFTFLSEL
VPFESPRYLQVHILHPPLVPGKYRSLLTDYISLAKTRLADLKVSIENMGLYEDLSSAGDI
TEPHSQALQDVEKAIMVFEHTGNIPVTVMEASIFRRPYYVSHFLPALLTPRVLPKVPDSR
VAFIESLKRADKIPPSLYSTYCQACSAAEEKPEDAALGVRAEPNSAEEPLGQLTAALGEL
RASMTDPSQRDVISAQVAVISERLRAVLGHNEDDSSVEISKIQLSINTPRLEPREHMAVD
LLLTSFCQNLMAASSVAPPERQGPWAALFVRTMCGRVLPAVLTRLCQLLRHQGPSLSAPH
VLGLAALAVHLGESRSALPEVDVGPPAPGAGLPVPALFDSLLTCRTRDSLFFCLKFCTAA
ISYSLCKFSSQSRDTLCSCLSPGLIKKFQFLMFRLFSEARQPLSEEDVASLSWRPLHLPS
ADWQRAALSLWTHRTFREVLKEEDVHLTYQDWLHLELEIQPEADALSDTERQDFHQWAIH
EHFLPESSASGGCDGDLQAACTILVNALMDFHQSSRSYDHSENSDLVFGGRTGNEDIISR
LQEMVADLELQQDLIVPLGHTPSQEHFLFEIFRRRLQALTSGWSVAASLQRQRELLMYKR
ILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFFRGLLN
ACLRSRDPSLMVDFILAKCQTKCPLILTSALVWWPSLEPVLLCRWRRHCQSPLPRELQKL
QEGRQFASDFLSPEAASPAPNPDWLSAAALHFAIQQVREENIRKQLKKLDCEREELLVFL
FFFSLMGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESDLRLGRLLL
RVAPDQHTRLLPFAFYSLLSYFHEDAAIREEAFLHVAVDMYLKLVQLFVAGDTSTVSPPA
GRSLELKGQGNPVELITKARLFLLQLIPRCPKKSFSHVAELLADRGDCDPEVSAALQSRQ
QAAPDADLSQEPHLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7kzpS	0.644	0.739	0.000	1250	0.854	0.994	7kzpS.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
2	AFDB:O15360	1.000	1.000	0.000	1455	1.000	1.000	O15360.pdb.gz	FANCA_HUMAN Fanconi anemia group A protein OS=Homo sapiens OX=9606 GN=FANCA PE=1 SV=2
3	AFDB:Q9JL70	0.751	0.758	0.000	1439	0.660	0.668	Q9JL70.pdb.gz	FANCA_MOUSE Fanconi anemia group A protein homolog OS=Mus musculus OX=10090 GN=Fanca PE=2 SV=2
4	PDB:7kzpA	0.480	0.586	1.701E-97	1186	0.811	0.995	7kzpA.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
5	AFDB:F4K2K3	0.177	0.183	4.064E-7	1375	0.113	0.120	F4K2K3.pdb.gz	GNL2_ARATH ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana OX=3702 GN=GNL2 PE=2 SV=1
6	AFDB:Q9R0L4	0.131	0.142	8.912E-7	1273	0.138	0.158	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
7	AFDB:Q583M5	0.117	0.111	9.236E-7	1621	0.128	0.115	Q583M5.pdb.gz	Q583M5_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.840 PE=3 SV=1
8	AFDB:Q9VLT1	0.127	0.117	9.236E-7	1684	0.150	0.129	Q9VLT1.pdb.gz	MON2_DROME Protein MON2 homolog OS=Drosophila melanogaster OX=7227 GN=mon2 PE=2 SV=4
9	AFDB:Q09804	0.154	0.162	1.104E-6	1318	0.123	0.136	Q09804.pdb.gz	URB2_SCHPO Probable nucleolar pre-ribosomal-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urb2 PE=3 SV=2
10	AFDB:Q14146	0.122	0.119	1.320E-6	1524	0.121	0.115	Q14146.pdb.gz	URB2_HUMAN Unhealthy ribosome biogenesis protein 2 homolog OS=Homo sapiens OX=9606 GN=URB2 PE=1 SV=2
11	AFDB:O75155	0.113	0.126	2.025E-6	1236	0.119	0.140	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
12	AFDB:Q3S4X5	0.085	0.101	2.336E-6	973	0.111	0.166	Q3S4X5.pdb.gz	Q3S4X5_DROME SNM OS=Drosophila melanogaster OX=7227 GN=SA2 PE=2 SV=1
13	PDB:6reyc	0.133	0.116	2.577E-6	1773	0.129	0.106	6reyc.pdb.gz	Characterization of Fully Recombinant Human 20S and 20S-PA200 Proteasome Complexes.
14	PDB:7sx3D	0.106	0.108	5.651E-6	1418	0.127	0.130	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.
15	PDB:7sukSP	0.126	0.094	8.673E-6	2234	0.126	0.082	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
16	PDB:4a0cA	0.141	0.163	9.315E-6	1155	0.103	0.130	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:7sicA	0.120	0.083	1.074E-5	2773	0.132	0.069	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
18	PDB:7mqaLM	0.111	0.094	1.379E-5	2041	0.146	0.104	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mqaSP	0.113	0.082	1.481E-5	2485	0.116	0.068	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6n1zA	0.125	0.167	2.622E-5	961	0.111	0.168	6n1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15360	0.0	2960	1455	1.000	1.000	FANCA_HUMAN Fanconi anemia group A protein OS=Homo sapiens OX=9606 GN=FANCA PE=1 SV=2
2	Q9JL70	0.0	1873	1439	0.664	0.671	FANCA_MOUSE Fanconi anemia group A protein homolog OS=Mus musculus OX=10090 GN=Fanca PE=2 SV=2
3	P35194	1.7	35.8	2493	0.036	0.021	UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP20 PE=1 SV=3
4	A0A1W6QDJ1	5.4	33.9	796	0.012	0.021	CPS4_ISORU Ent-copalyl diphosphate synthase 4 OS=Isodon rubescens OX=587669 GN=CPS4 PE=1 SV=1
5	Q383F6	6.0	33.9	4242	0.028	0.010	Q383F6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3010 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03511 Fanconi_A	4.3e-28	108.2	Fanconi anaemia group A protein
2	PF15865 Fanconi_A_N	4.2e-165	561.0	Fanconi anaemia group A protein N terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229769	0.999	Fanconi anemia group E protein
2	9606.ENSP00000267430	0.999	Fanconi anemia group M protein
3	9606.ENSP00000289081	0.999	Fanconi anemia group C protein
4	9606.ENSP00000308583	0.999	Centromere protein S
5	9606.ENSP00000317039	0.999	RecQ-mediated genome instability protein 1
6	9606.ENSP00000330875	0.999	Fanconi anemia group F protein
7	9606.ENSP00000333283	0.999	Fanconi anemia core complex-associated protein 100
8	9606.ENSP00000347232	0.999	Bloom syndrome protein
9	9606.ENSP00000367910	0.999	Fanconi anemia group G protein
10	9606.ENSP00000376168	0.999	Centromere protein X
11	9606.ENSP00000381378	0.999	Fanconi anemia group B protein
12	9606.ENSP00000383710	0.999	Fanconi anemia core complex-associated protein 20
13	9606.ENSP00000385021	0.999	E3 ubiquitin-protein ligase FANCL
14	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
15	9606.ENSP00000442336	0.999	DNA topoisomerase 3-alpha
16	9606.ENSP00000466121	0.999	Fanconi anemia core complex-associated protein 24
17	9606.ENSP00000287647	0.996	Fanconi anemia group D2 protein
18	9606.ENSP00000310842	0.995	Fanconi anemia group I protein
19	9606.ENSP00000356243	0.987	Ubiquitin-conjugating enzyme E2 T
20	9606.ENSP00000254719	0.975	Replication protein A 70 kDa DNA-binding subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006259	0.991	DNA metabolic process
GO:0006974	0.990	cellular response to DNA damage stimulus
GO:0006281	0.980	DNA repair
GO:0016043	0.901	cellular component organization
GO:0006513	0.898	protein monoubiquitination
GO:0022607	0.882	cellular component assembly
GO:0050789	0.786	regulation of biological process
GO:0050794	0.735	regulation of cellular process
GO:0043933	0.718	protein-containing complex organization
GO:0065003	0.705	protein-containing complex assembly
GO:0019222	0.433	regulation of metabolic process
GO:0080090	0.423	regulation of primary metabolic process
GO:0060255	0.414	regulation of macromolecule metabolic process
GO:0051171	0.360	regulation of nitrogen compound metabolic process
GO:0031323	0.336	regulation of cellular metabolic process
GO:0006996	0.301	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0000785	0.999	chromatin
GO:0043240	0.755	Fanconi anaemia nuclear complex
GO:0005829	0.305	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]