StarFunc result for job id O15370

User Input

>input (315 residues)
MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMD
QWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPA
KARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELLEVRLVE
TPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEEG
EEETVASGEESLGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA
GDWRPSSIADLVFTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15370	1.000	1.000	2.998E-51	315	1.000	1.000	O15370.pdb.gz	SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens OX=9606 GN=SOX12 PE=2 SV=2
2	AFDB:Q9I9C8	0.279	0.249	3.543E-20	354	0.432	0.384	Q9I9C8.pdb.gz	Q9I9C8_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=cb237 PE=2 SV=1
3	AFDB:Q9YH22	0.306	0.266	4.329E-20	368	0.451	0.386	Q9YH22.pdb.gz
4	AFDB:Q5TZG4	0.276	0.237	3.671E-19	368	0.460	0.394	Q5TZG4.pdb.gz
5	AFDB:Q8AXQ4	0.284	0.365	2.094E-16	244	0.381	0.492	Q8AXQ4.pdb.gz	SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis OX=8355 GN=sox12 PE=2 SV=1
6	AFDB:Q6P0E1	0.271	0.271	8.036E-12	315	0.302	0.302	Q6P0E1.pdb.gz	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
7	AFDB:Q6DGL6	0.256	0.240	1.122E-11	336	0.257	0.241	Q6DGL6.pdb.gz	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
8	AFDB:Q8T3B9	0.292	0.231	1.200E-11	404	0.324	0.252	Q8T3B9.pdb.gz	SEM2_CAEEL Transcription factor sem-2 OS=Caenorhabditis elegans OX=6239 GN=sem-2 PE=2 SV=1
9	AFDB:O42342	0.273	0.240	4.269E-11	362	0.260	0.227	O42342.pdb.gz	SOX7_XENLA Transcription factor Sox-7 OS=Xenopus laevis OX=8355 GN=sox7 PE=2 SV=1
10	AFDB:Q2Z1R2	0.254	0.235	4.269E-11	340	0.279	0.259	Q2Z1R2.pdb.gz	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
11	PDB:1j5nA	0.194	0.605	7.501E-3	93	0.051	0.172	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.144	0.102	4.415E-1	451	0.038	0.027	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:5b63C	0.090	0.055	1.202	553	0.032	0.018	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
14	PDB:1kw2A	0.107	0.077	2.507	455	0.035	0.024	1kw2A.pdb.gz
15	PDB:7fbyA	0.078	0.160	3.064	153	0.025	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:2gqqC	0.082	0.151	3.275	157	0.038	0.076	2gqqC.pdb.gz
17	PDB:2cyyA	0.079	0.142	4.279	151	0.041	0.086	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:2hh7A	0.078	0.250	4.574	85	0.029	0.106	2hh7A.pdb.gz
19	PDB:4uhvB	0.102	0.059	4.890	645	0.063	0.031	4uhvB.pdb.gz
20	PDB:2vbwA	0.078	0.165	5.976	147	0.029	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15370	0.0	622	315	1.000	1.000	SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens OX=9606 GN=SOX12 PE=2 SV=2
2	Q04890	2.57e-145	413	314	0.949	0.952	SOX12_MOUSE Transcription factor SOX-12 OS=Mus musculus OX=10090 GN=Sox12 PE=1 SV=2
3	Q6P2A2	2.10e-72	229	342	0.457	0.421	Q6P2A2_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=zgc:63851 PE=2 SV=1
4	Q6P0Z4	2.58e-68	219	363	0.460	0.399	Q6P0Z4_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=sox4 PE=2 SV=2
5	P40650	8.28e-68	218	374	0.454	0.382	SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis OX=8355 GN=sox11-b PE=1 SV=2
6	Q06831	1.01e-51	178	440	0.276	0.198	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
7	A0A8I5ZQY6	2.53e-51	177	440	0.270	0.193	A0A8I5ZQY6_RAT Transcription factor SOX OS=Rattus norvegicus OX=10116 GN=Sox4 PE=4 SV=1
8	Q9DG48	7.82e-51	174	379	0.270	0.224	Q9DG48_XENLA Transcription factor SOX OS=Xenopus laevis OX=8355 GN=Sox4 PE=2 SV=1
9	Q91731	9.74e-51	174	382	0.251	0.207	SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis OX=8355 GN=sox11-a PE=1 SV=2
10	Q06945	9.80e-51	176	474	0.260	0.173	SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens OX=9606 GN=SOX4 PE=1 SV=1
11	Q7M6Y2	2.54e-50	173	395	0.244	0.195	SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus OX=10090 GN=Sox11 PE=1 SV=1
12	P0C1G9	3.04e-50	173	395	0.244	0.195	SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1
13	P48435	3.06e-49	170	396	0.241	0.192	SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus OX=9031 GN=SOX11 PE=2 SV=1
14	Q8AXQ4	1.86e-48	164	244	0.241	0.311	SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis OX=8355 GN=sox12 PE=2 SV=1
15	Q9I9C8	8.92e-44	155	354	0.206	0.184	Q9I9C8_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=cb237 PE=2 SV=1
16	Q9I9C7	1.36e-42	152	368	0.203	0.174	Q9I9C7_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=fc90d10 PE=2 SV=1
17	O57399	1.73e-42	152	367	0.203	0.174	O57399_ONCMY Transcription factor SOX OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00079394001 PE=2 SV=1
18	P40656	8.15e-34	132	669	0.181	0.085	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3
19	P43267	1.25e-32	122	231	0.194	0.264	SOX15_MOUSE Protein SOX-15 OS=Mus musculus OX=10090 GN=Sox15 PE=1 SV=3
20	O55170	6.75e-32	125	466	0.168	0.114	SOX10_RAT Transcription factor SOX-10 OS=Rattus norvegicus OX=10116 GN=Sox10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	1.3e-22	91.3	HMG (high mobility group) box
2	PF09011 HMG_box_2	0.00012	33.9	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371728	0.585	Neurensin-2
2	9606.ENSP00000362103	0.533	POU domain, class 3, transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.960	protein binding
GO:0140110	0.939	transcription regulator activity
GO:0003700	0.931	DNA-binding transcription factor activity
GO:0000981	0.759	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.558	transcription cis-regulatory region binding
GO:0001216	0.470	DNA-binding transcription activator activity
GO:0001228	0.457	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.997	regulation of metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048518	0.973	positive regulation of biological process
GO:0032502	0.952	developmental process
GO:0032501	0.937	multicellular organismal process
GO:0006357	0.937	regulation of transcription by RNA polymerase II
GO:0009891	0.928	positive regulation of biosynthetic process
GO:0048856	0.923	anatomical structure development
GO:0048522	0.835	positive regulation of cellular process
GO:0007275	0.813	multicellular organism development
GO:0031325	0.808	positive regulation of cellular metabolic process
GO:0010604	0.807	positive regulation of macromolecule metabolic process
GO:0051173	0.773	positive regulation of nitrogen compound metabolic process
GO:0031328	0.773	positive regulation of cellular biosynthetic process
GO:0010557	0.714	positive regulation of macromolecule biosynthetic process
GO:0045893	0.668	positive regulation of DNA-templated transcription
GO:0048731	0.646	system development
GO:0009987	0.506	cellular process
GO:0045944	0.472	positive regulation of transcription by RNA polymerase II
GO:0048523	0.389	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0043228	0.375	non-membrane-bounded organelle
GO:0043232	0.374	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]