StarFunc result for job id O15371

User Input

>input (548 residues)
MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYS
SQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQ
ILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLM
KMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAK
TQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQ
DEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRY
RRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQI
NLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEE
EEEEEEET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15371	1.000	1.000	0.000	548	1.000	1.000	O15371.pdb.gz	EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1
2	AFDB:K7IM66	0.700	0.688	1.586E-74	558	0.597	0.586	K7IM66.pdb.gz	EIF3D_NASVI Eukaryotic translation initiation factor 3 subunit D OS=Nasonia vitripennis OX=7425 PE=1 SV=1
3	PDB:7a09N	0.657	0.803	3.543E-73	447	0.816	1.000	7a09N.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
4	AFDB:Q9VCK0	0.695	0.680	1.706E-68	560	0.562	0.550	Q9VCK0.pdb.gz	EI3D1_DROME Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila melanogaster OX=7227 GN=eIF3d1 PE=1 SV=1
5	AFDB:P30642	0.673	0.647	2.760E-59	570	0.451	0.433	P30642.pdb.gz	EIF3D_CAEEL Eukaryotic translation initiation factor 3 subunit D OS=Caenorhabditis elegans OX=6239 GN=eif-3.D PE=1 SV=1
6	AFDB:P56820	0.686	0.637	7.597E-58	591	0.418	0.387	P56820.pdb.gz	EIF3D_ARATH Eukaryotic translation initiation factor 3 subunit D OS=Arabidopsis thaliana OX=3702 GN=TIF3D1 PE=1 SV=1
7	AFDB:Q9FKV6	0.681	0.636	4.220E-57	588	0.403	0.376	Q9FKV6.pdb.gz	Q9FKV6_ARATH Eukaryotic translation initiation factor 3 subunit D OS=Arabidopsis thaliana OX=3702 GN=At5g44320 PE=1 SV=1
8	AFDB:O94236	0.687	0.664	6.558E-56	567	0.416	0.402	O94236.pdb.gz	EIF3D_SCHPO Eukaryotic translation initiation factor 3 subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=moe1 PE=1 SV=1
9	PDB:6w2t9	0.643	0.987	3.510E-55	356	0.443	0.683	6w2t9.pdb.gz	A complex IRES at the 5'-UTR of a viral mRNA assembles a functional 48S complex via an uAUG intermediate.
10	AFDB:Q554U9	0.665	0.691	3.952E-53	527	0.391	0.406	Q554U9.pdb.gz	EIF3D_DICDI Eukaryotic translation initiation factor 3 subunit D OS=Dictyostelium discoideum OX=44689 GN=eif3d PE=3 SV=1
11	AFDB:Q4Q6Y6	0.614	0.633	9.229E-35	531	0.224	0.232	Q4Q6Y6.pdb.gz	Q4Q6Y6_LEIMA Eukaryotic translation initiation factor 3 subunit 7-like protein OS=Leishmania major OX=5664 GN=LMJF_30_3040 PE=4 SV=2
12	AFDB:Q587A3	0.611	0.659	8.574E-34	506	0.241	0.261	Q587A3.pdb.gz	Q587A3_TRYB2 Eukaryotic translation initiation factor 3 subunit 7-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.950 PE=4 SV=1
13	PDB:6aixA	0.409	0.595	3.072E-12	358	0.086	0.131	6aixA.pdb.gz	Molecular mechanism for the inhibition of DXO by adenosine 3',5'-bisphosphate.
14	PDB:3fqdB	0.357	0.558	3.588E-11	332	0.075	0.123	3fqdB.pdb.gz	Structure and function of the 5'-->3' exoribonuclease Rat1 and its activating partner Rai1.
15	PDB:6wugA	0.366	0.600	5.667E-11	312	0.075	0.131	6wugA.pdb.gz	DXO/Rai1 enzymes remove 5'-end FAD and dephospho-CoA caps on RNAs.
16	PDB:4gpuA	0.345	0.535	5.096E-8	331	0.071	0.118	4gpuA.pdb.gz	Dxo1 is a new type of eukaryotic enzyme with both decapping and 5'-3' exoribonuclease activity.
17	PDB:4ic1D	0.125	0.278	1.960E-2	206	0.029	0.078	4ic1D.pdb.gz	Toroidal structure and DNA cleavage by the CRISPR-associated [4Fe-4S] cluster containing Cas4 nuclease SSO0001 from Sulfolobus solfataricus.
18	PDB:7lw7A	0.087	0.146	4.120E-2	277	0.055	0.108	7lw7A.pdb.gz	EXO5-DNA structure and BLM interactions direct DNA resection critical for ATR-dependent replication restart.
19	PDB:2qb6A	0.079	0.101	1.368E-1	393	0.040	0.056	2qb6A.pdb.gz	The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
20	PDB:2hqsA	0.044	0.055	3.414E-1	412	0.024	0.032	2hqsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7IM66	0.0	689	558	0.595	0.584	EIF3D_NASVI Eukaryotic translation initiation factor 3 subunit D OS=Nasonia vitripennis OX=7425 PE=1 SV=1
2	O15371	0.0	1150	548	1.000	1.000	EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1
3	O70194	0.0	1142	548	0.989	0.989	EIF3D_MOUSE Eukaryotic translation initiation factor 3 subunit D OS=Mus musculus OX=10090 GN=Eif3d PE=1 SV=2
4	Q9VCK0	0.0	647	560	0.566	0.554	EI3D1_DROME Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila melanogaster OX=7227 GN=eIF3d1 PE=1 SV=1
5	P30642	2.50e-150	445	570	0.454	0.437	EIF3D_CAEEL Eukaryotic translation initiation factor 3 subunit D OS=Caenorhabditis elegans OX=6239 GN=eif-3.D PE=1 SV=1
6	P56820	5.46e-140	419	591	0.440	0.408	EIF3D_ARATH Eukaryotic translation initiation factor 3 subunit D OS=Arabidopsis thaliana OX=3702 GN=TIF3D1 PE=1 SV=1
7	O94236	7.35e-139	415	567	0.420	0.406	EIF3D_SCHPO Eukaryotic translation initiation factor 3 subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=moe1 PE=1 SV=1
8	Q9FKV6	2.37e-134	404	588	0.420	0.391	Q9FKV6_ARATH Eukaryotic translation initiation factor 3 subunit D OS=Arabidopsis thaliana OX=3702 GN=At5g44320 PE=1 SV=1
9	Q554U9	6.26e-121	368	527	0.380	0.395	EIF3D_DICDI Eukaryotic translation initiation factor 3 subunit D OS=Dictyostelium discoideum OX=44689 GN=eif3d PE=3 SV=1
10	Q587A3	3.12e-31	129	506	0.217	0.235	Q587A3_TRYB2 Eukaryotic translation initiation factor 3 subunit 7-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.950 PE=4 SV=1
11	Q4Q6Y6	7.15e-23	104	531	0.173	0.179	Q4Q6Y6_LEIMA Eukaryotic translation initiation factor 3 subunit 7-like protein OS=Leishmania major OX=5664 GN=LMJF_30_3040 PE=4 SV=2
12	Q57ZJ1	0.86	34.7	395	0.038	0.053	Q57ZJ1_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.130 PE=4 SV=1
13	P14340	1.6	34.3	3391	0.040	0.006	POLG_DEN2N Genome polyprotein OS=Dengue virus type 2 (strain Thailand/NGS-C/1944) OX=11065 PE=1 SV=2
14	Q9E7P0	1.8	34.3	3391	0.040	0.006	Q9E7P0_9FLAV Genome polyprotein OS=dengue virus type 2 OX=11060 PE=1 SV=1
15	P29990	2.5	33.5	3391	0.040	0.006	POLG_DEN26 Genome polyprotein OS=Dengue virus type 2 (strain Thailand/16681/1984) OX=31634 PE=1 SV=1
16	P29991	2.5	33.5	3391	0.040	0.006	POLG_DEN27 Genome polyprotein OS=Dengue virus type 2 (strain 16681-PDK53) OX=31635 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05091 eIF-3_zeta	8.8e-213	719.7	Eukaryotic translation initiation factor 3 subunit 7 (eIF-3)
2	PF10505 NARG2_C	1.4	19.9	NMDA receptor-regulated gene protein 2 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000024428

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001723	0.999	Eukaryotic translation initiation factor 3 subunit C
2	61853.ENSNLEP00000002941	0.999	Eukaryotic translation initiation factor 3 subunit I
3	61853.ENSNLEP00000005058	0.999	Eukaryotic translation initiation factor 3 subunit E
4	61853.ENSNLEP00000005825	0.999	Eukaryotic translation initiation factor 3 subunit H
5	61853.ENSNLEP00000010568	0.999	Eukaryotic translation initiation factor 3 subunit B
6	61853.ENSNLEP00000014680	0.999	Eukaryotic translation initiation factor 3 subunit G
7	61853.ENSNLEP00000018200	0.999	Eukaryotic translation initiation factor 3 subunit L
8	61853.ENSNLEP00000020219	0.999	Eukaryotic translation initiation factor 3 subunit A
9	61853.ENSNLEP00000021738	0.999	Eukaryotic translation initiation factor 3 subunit M
10	61853.ENSNLEP00000023363	0.999	Eukaryotic translation initiation factor 3 subunit F
11	61853.ENSNLEP00000020429	0.998	Eukaryotic translation initiation factor 3 subunit K
12	61853.ENSNLEP00000000790	0.996	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
13	61853.ENSNLEP00000006758	0.995	Eukaryotic translation initiation factor 3 subunit J
14	61853.ENSNLEP00000007040	0.980	40S ribosomal protein S3a
15	61853.ENSNLEP00000022016	0.979	Ribosomal protein S4, X-linked
16	61853.ENSNLEP00000024062	0.979	Uncharacterized protein
17	61853.ENSNLEP00000022940	0.978	Ribosomal protein S15a
18	61853.ENSNLEP00000019545	0.976	Eukaryotic translation initiation factor 5
19	61853.ENSNLEP00000006813	0.973	40S ribosomal protein SA
20	61853.ENSNLEP00000018700	0.966	Ribosomal protein S7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003743	1.000	translation initiation factor activity
GO:0005515	0.999	protein binding
GO:0003729	0.999	mRNA binding
GO:0000339	0.996	RNA cap binding
GO:0098808	0.641	mRNA cap binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0044260	0.982	cellular macromolecule metabolic process
GO:0010467	0.979	gene expression
GO:0009059	0.978	macromolecule biosynthetic process
GO:0044271	0.977	cellular nitrogen compound biosynthetic process
GO:0006518	0.970	peptide metabolic process
GO:0002181	0.958	cytoplasmic translation
GO:0006413	0.945	translational initiation
GO:0002183	0.923	cytoplasmic translational initiation
GO:0065007	0.849	biological regulation
GO:0050794	0.841	regulation of cellular process
GO:0022613	0.838	ribonucleoprotein complex biogenesis
GO:0051171	0.808	regulation of nitrogen compound metabolic process
GO:0060255	0.806	regulation of macromolecule metabolic process
GO:0080090	0.799	regulation of primary metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0022618	0.756	ribonucleoprotein complex assembly
GO:0010468	0.683	regulation of gene expression
GO:0031326	0.675	regulation of cellular biosynthetic process
GO:0010556	0.671	regulation of macromolecule biosynthetic process
GO:0051246	0.601	regulation of protein metabolic process
GO:0048518	0.547	positive regulation of biological process
GO:0048522	0.429	positive regulation of cellular process
GO:0006417	0.325	regulation of translation
GO:0010604	0.315	positive regulation of macromolecule metabolic process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005737	0.998	cytoplasm
GO:0005852	0.990	eukaryotic translation initiation factor 3 complex
GO:0016020	0.989	membrane
GO:0005829	0.985	cytosol
GO:0030054	0.876	cell junction
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0005634	0.735	nucleus
GO:0070013	0.635	intracellular organelle lumen
GO:0031981	0.629	nuclear lumen
GO:0005654	0.321	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]