StarFunc result for job id O15372

User Input

>input (352 residues)
MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGT
EVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWY
QSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEK
DFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLG
KNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEED
LSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15372	1.000	1.000	1.241E-65	352	1.000	1.000	O15372.pdb.gz	EIF3H_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1
2	AFDB:Q6AXJ2	0.900	0.946	8.709E-56	335	0.798	0.839	Q6AXJ2.pdb.gz	EI3HA_DANRE Eukaryotic translation initiation factor 3 subunit H-A OS=Danio rerio OX=7955 GN=eif3ha PE=2 SV=1
3	AFDB:Q5PR67	0.909	0.961	2.376E-55	333	0.787	0.832	Q5PR67.pdb.gz	EI3HB_DANRE Eukaryotic translation initiation factor 3 subunit H-B OS=Danio rerio OX=7955 GN=eif3hb PE=2 SV=2
4	AFDB:Q9U9Q4	0.885	0.921	5.121E-39	338	0.415	0.432	Q9U9Q4.pdb.gz	EIF3H_DROME Eukaryotic translation initiation factor 3 subunit H OS=Drosophila melanogaster OX=7227 GN=eIF3h PE=1 SV=2
5	AFDB:Q9C5Z2	0.825	0.861	1.317E-34	337	0.375	0.392	Q9C5Z2.pdb.gz	EIF3H_ARATH Eukaryotic translation initiation factor 3 subunit H OS=Arabidopsis thaliana OX=3702 GN=TIF3H1 PE=1 SV=2
6	PDB:6ybd8	0.571	0.626	5.355E-34	317	0.901	1.000	6ybd8.pdb.gz
7	AFDB:Q9UT48	0.828	0.817	9.807E-29	357	0.264	0.261	Q9UT48.pdb.gz	EIF3H_SCHPO Eukaryotic translation initiation factor 3 subunit H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eif3h PE=1 SV=1
8	AFDB:Q4QIM7	0.613	0.642	2.242E-15	335	0.142	0.149	Q4QIM7.pdb.gz	Q4QIM7_LEIMA JAB1/MPN/MOV34 metalloenzyme domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0640 PE=4 SV=1
9	AFDB:Q9V3H2	0.446	0.506	1.318E-14	308	0.179	0.205	Q9V3H2.pdb.gz	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
10	AFDB:A3KNN5	0.441	0.498	1.398E-14	310	0.185	0.210	A3KNN5.pdb.gz	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
11	AFDB:Q9LT08	0.440	0.499	1.398E-14	308	0.170	0.195	Q9LT08.pdb.gz	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
12	PDB:5l4kV	0.434	0.515	2.487E-13	293	0.153	0.184	5l4kV.pdb.gz
13	PDB:5gjqV	0.415	0.557	9.116E-13	257	0.170	0.233	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
14	PDB:6r7fE	0.506	0.562	1.551E-12	311	0.165	0.186	6r7fE.pdb.gz
15	PDB:5mpbV	0.405	0.486	2.799E-12	289	0.153	0.187	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:3jckG	0.415	0.557	6.030E-12	257	0.153	0.210	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
17	PDB:6zonF	0.392	0.500	2.487E-10	269	0.162	0.212	6zonF.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
18	PDB:5l4kU	0.390	0.461	7.199E-10	292	0.165	0.199	5l4kU.pdb.gz
19	PDB:6j30U	0.374	0.492	1.155E-9	262	0.185	0.248	6j30U.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
20	PDB:6fvtU	0.359	0.406	1.026E-8	304	0.148	0.171	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15372	0.0	736	352	1.000	1.000	EIF3H_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1
2	Q5PR67	0.0	538	333	0.787	0.832	EI3HB_DANRE Eukaryotic translation initiation factor 3 subunit H-B OS=Danio rerio OX=7955 GN=eif3hb PE=2 SV=2
3	Q6AXJ2	0.0	559	335	0.790	0.830	EI3HA_DANRE Eukaryotic translation initiation factor 3 subunit H-A OS=Danio rerio OX=7955 GN=eif3ha PE=2 SV=1
4	Q6IB98	0.0	736	352	1.000	1.000	Q6IB98_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3S3 PE=1 SV=1
5	Q91WK2	0.0	716	352	0.972	0.972	EIF3H_MOUSE Eukaryotic translation initiation factor 3 subunit H OS=Mus musculus OX=10090 GN=Eif3h PE=1 SV=1
6	Q9U9Q4	4.78e-104	311	338	0.423	0.441	EIF3H_DROME Eukaryotic translation initiation factor 3 subunit H OS=Drosophila melanogaster OX=7227 GN=eIF3h PE=1 SV=2
7	Q9C5Z2	5.02e-78	244	337	0.386	0.404	EIF3H_ARATH Eukaryotic translation initiation factor 3 subunit H OS=Arabidopsis thaliana OX=3702 GN=TIF3H1 PE=1 SV=2
8	Q9UT48	5.49e-39	144	357	0.281	0.277	EIF3H_SCHPO Eukaryotic translation initiation factor 3 subunit H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eif3h PE=1 SV=1
9	P43588	8.82e-11	64.3	306	0.148	0.170	RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN11 PE=1 SV=1
10	Q9V3H2	3.11e-10	62.8	308	0.128	0.146	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
11	P41878	5.87e-10	62.0	308	0.122	0.140	RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn11 PE=1 SV=2
12	A3KNN5	7.42e-10	61.6	310	0.125	0.142	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
13	A0A8I6AHX8	7.99e-10	61.2	285	0.119	0.147	A0A8I6AHX8_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
14	O00487	1.35e-09	60.8	310	0.119	0.135	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
15	O35593	1.35e-09	60.8	310	0.119	0.135	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
16	Q17QP9	1.35e-09	60.8	310	0.119	0.135	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1
17	Q4V8E2	1.35e-09	60.8	310	0.119	0.135	Q4V8E2_RAT Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
18	A0A0G2JZJ1	1.44e-09	60.8	306	0.119	0.137	A0A0G2JZJ1_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
19	O76577	6.07e-09	58.9	312	0.114	0.128	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1
20	Q8WRU0	7.19e-09	58.5	305	0.131	0.151	Q8WRU0_9TRYP Proteasome regulatory non-ATP-ase subunit 11 OS=Trypanosoma brucei OX=5691 GN=Rpn11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19445 eIF3h_C	3.7e-106	364.7	C-terminal region of eIF3h
2	PF01398 JAB	2.8e-20	83.9	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
3	PF15273 NHS	92	13.5	NHS-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429931

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216190	0.999	Eukaryotic translation initiation factor 3 subunit D
2	9606.ENSP00000220849	0.999	Eukaryotic translation initiation factor 3 subunit E
3	9606.ENSP00000248342	0.999	Eukaryotic translation initiation factor 3 subunit K
4	9606.ENSP00000253108	0.999	Eukaryotic translation initiation factor 3 subunit G
5	9606.ENSP00000332604	0.999	Eukaryotic translation initiation factor 3 subunit C
6	9606.ENSP00000354125	0.999	Eukaryotic translation initiation factor 3 subunit B
7	9606.ENSP00000358140	0.999	Eukaryotic translation initiation factor 3 subunit A
8	9606.ENSP00000362688	0.999	Eukaryotic translation initiation factor 3 subunit I
9	9606.ENSP00000431800	0.999	Eukaryotic translation initiation factor 3 subunit F
10	9606.ENSP00000436049	0.999	Eukaryotic translation initiation factor 3 subunit M
11	9606.ENSP00000485663	0.999	Eukaryotic translation initiation factor 3 subunit L
12	9606.ENSP00000261868	0.998	Eukaryotic translation initiation factor 3 subunit J
13	9606.ENSP00000370258	0.997	Eukaryotic translation initiation factor 3 subunit C-like protein
14	9606.ENSP00000379888	0.994	Ribosomal protein S8
15	9606.ENSP00000369757	0.993	40S ribosomal protein S6
16	9606.ENSP00000346050	0.992	40S ribosomal protein S3a
17	9606.ENSP00000368927	0.992	Eukaryotic translation initiation factor 1A, X-chromosomal
18	9606.ENSP00000435096	0.986	Ribosomal protein S25
19	9606.ENSP00000339095	0.985	40S ribosomal protein S7
20	9606.ENSP00000379339	0.982	Ribosomal protein S29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.990	RNA binding
GO:0003824	0.965	catalytic activity
GO:0016787	0.949	hydrolase activity
GO:0101005	0.841	deubiquitinase activity
GO:0008237	0.834	metallopeptidase activity
GO:0140492	0.770	metal-dependent deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.998	macromolecule metabolic process
GO:1901564	0.998	organonitrogen compound metabolic process
GO:0043603	0.997	amide metabolic process
GO:1901576	0.997	organic substance biosynthetic process
GO:0044271	0.997	cellular nitrogen compound biosynthetic process
GO:0006412	0.993	translation
GO:0006413	0.983	translational initiation
GO:0050789	0.867	regulation of biological process
GO:0050794	0.863	regulation of cellular process
GO:0051171	0.678	regulation of nitrogen compound metabolic process
GO:0080090	0.677	regulation of primary metabolic process
GO:0060255	0.675	regulation of macromolecule metabolic process
GO:0031323	0.670	regulation of cellular metabolic process
GO:0051246	0.619	regulation of protein metabolic process
GO:0010468	0.572	regulation of gene expression
GO:0031326	0.572	regulation of cellular biosynthetic process
GO:0010556	0.562	regulation of macromolecule biosynthetic process
GO:0006417	0.496	regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005852	0.995	eukaryotic translation initiation factor 3 complex
GO:0005829	0.987	cytosol
GO:0043226	0.981	organelle
GO:0043227	0.967	membrane-bounded organelle
GO:0005576	0.944	extracellular region
GO:0016020	0.917	membrane
GO:0065010	0.832	extracellular membrane-bounded organelle
GO:1903561	0.821	extracellular vesicle
GO:0070062	0.808	extracellular exosome
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0043232	0.651	intracellular non-membrane-bounded organelle
GO:0070013	0.504	intracellular organelle lumen
GO:0031981	0.438	nuclear lumen
GO:0005654	0.412	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.949	Hydrolases.
EC:3.4.-.-	0.841	Acting on peptide bonds (peptidases).

[back to server]