StarFunc result for job id O15374

User Input

>input (487 residues)
MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIG
WIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLL
PGLGSAFLYQVAAVVTTKYFKKRLALSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALIL
FGAIALNLVPSSMLLRPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDS
TTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPF
FYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQ
NWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRN
STVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAE
RWKNSLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15374	1.000	1.000	5.536E-62	487	1.000	1.000	O15374.pdb.gz	MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1
2	AFDB:Q6ZSM3	0.754	0.714	8.449E-25	516	0.275	0.260	Q6ZSM3.pdb.gz	MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3
3	AFDB:D4A734	0.725	0.726	2.776E-24	486	0.283	0.284	D4A734.pdb.gz	MOT12_RAT Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=1 SV=1
4	AFDB:Q7JWI7	0.755	0.566	8.712E-23	658	0.244	0.181	Q7JWI7.pdb.gz	Q7JWI7_DROME Hermes, isoform A OS=Drosophila melanogaster OX=7227 GN=hrm PE=1 SV=1
5	AFDB:Q7RTY0	0.745	0.848	1.027E-22	426	0.253	0.289	Q7RTY0.pdb.gz	MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens OX=9606 GN=SLC16A13 PE=1 SV=1
6	AFDB:O15403	0.748	0.699	1.260E-22	523	0.259	0.241	O15403.pdb.gz	MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2
7	AFDB:O70451	0.669	0.672	2.983E-22	484	0.263	0.264	O70451.pdb.gz	MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus OX=10090 GN=Slc16a7 PE=1 SV=1
8	AFDB:Q7RTY1	0.676	0.650	3.373E-22	509	0.255	0.244	Q7RTY1.pdb.gz	MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1
9	AFDB:Q63344	0.667	0.665	6.503E-22	489	0.251	0.249	Q63344.pdb.gz	MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc16a7 PE=1 SV=2
10	AFDB:A0A024RBB2	0.687	0.698	7.059E-22	478	0.232	0.236	A0A024RBB2.pdb.gz
11	PDB:7yr5A	0.654	0.805	1.860E-15	385	0.218	0.275	7yr5A.pdb.gz
12	PDB:7bp3A	0.642	0.774	1.619E-12	394	0.224	0.277	7bp3A.pdb.gz
13	PDB:6s4mA	0.573	0.646	1.292E-8	426	0.136	0.155	6s4mA.pdb.gz
14	PDB:7sptA	0.628	0.648	2.390E-8	470	0.113	0.117	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
15	PDB:5oxpA	0.523	0.546	8.183E-8	462	0.146	0.154	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
16	PDB:7aaqA	0.597	0.597	1.453E-7	487	0.142	0.142	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:7zh0A	0.555	0.547	1.644E-7	495	0.099	0.097	7zh0A.pdb.gz
18	PDB:3o7qA	0.592	0.682	1.859E-7	414	0.138	0.162	3o7qA.pdb.gz
19	PDB:6thaA	0.550	0.589	2.190E-7	448	0.123	0.134	6thaA.pdb.gz
20	PDB:4ybqB	0.585	0.612	2.378E-7	462	0.138	0.145	4ybqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15374	0.0	997	487	1.000	1.000	MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1
2	Q8BGC3	4.29e-66	222	486	0.302	0.302	MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1
3	D4A734	1.63e-64	218	486	0.304	0.305	MOT12_RAT Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=1 SV=1
4	Q6ZSM3	2.69e-62	213	516	0.302	0.285	MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3
5	Q7RTY1	2.94e-50	181	509	0.283	0.271	MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1
6	O15403	1.31e-49	179	523	0.269	0.250	MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2
7	O70451	8.15e-49	176	484	0.273	0.275	MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus OX=10090 GN=Slc16a7 PE=1 SV=1
8	P53988	2.25e-48	175	484	0.263	0.264	MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus OX=10036 GN=SLC16A7 PE=1 SV=1
9	Q63344	2.11e-46	170	489	0.267	0.266	MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc16a7 PE=1 SV=2
10	O60669	1.02e-44	165	478	0.257	0.262	MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens OX=9606 GN=SLC16A7 PE=1 SV=2
11	F8W0N3	2.15e-44	163	435	0.257	0.287	F8W0N3_HUMAN Solute carrier family 16 member 7 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A7 PE=1 SV=1
12	H6WYF6	3.12e-33	134	495	0.224	0.220	H6WYF6_DANRE Solute carrier family 16 member 6a OS=Danio rerio OX=7955 GN=Slc16a6a PE=1 SV=1
13	P53985	4.01e-33	133	500	0.236	0.230	MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3
14	Q5T8R5	4.61e-33	132	456	0.232	0.248	Q5T8R5_HUMAN Monocarboxylate transporter 1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=1
15	P53986	2.24e-32	131	493	0.234	0.231	MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus OX=10090 GN=Slc16a1 PE=1 SV=1
16	Q03064	2.58e-30	125	494	0.226	0.223	MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus OX=10030 GN=SLC16A1 PE=1 SV=1
17	P53987	6.89e-30	124	494	0.230	0.227	MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc16a1 PE=1 SV=1
18	Q8K1P8	8.66e-27	115	545	0.216	0.193	MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus OX=10116 GN=SLC16A2 PE=1 SV=2
19	O70324	9.25e-27	115	545	0.216	0.193	MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus OX=10090 GN=Slc16a2 PE=1 SV=2
20	Q5T8R3	3.02e-26	110	296	0.138	0.226	Q5T8R3_HUMAN Monocarboxylate transporter 1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1.6e-32	124.5	Major Facilitator Superfamily
2	PF02535 Zip	2.2e+02	12.4	ZIP Zinc transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333769	0.898	Basigin
2	9606.ENSP00000401277	0.830	E3 ubiquitin-protein ligase Hakai
3	9606.ENSP00000367608	0.820	Carbonic anhydrase 9
4	9606.ENSP00000445175	0.779	Lactate dehydrogenase A
5	9606.ENSP00000416293	0.774	Solute carrier family 2, facilitated glucose transporter member 1
6	9606.ENSP00000437955	0.730	Hypoxia-inducible factor 1-alpha
7	9606.ENSP00000075120	0.729	Solute carrier family 2, facilitated glucose transporter member 3
8	9606.ENSP00000445929	0.729	Solute carrier family 2, facilitated glucose transporter member 14
9	9606.ENSP00000321271	0.688	Peroxisomal membrane protein 2
10	9606.ENSP00000360365	0.683	Malignant T-cell-amplified sequence 1
11	9606.ENSP00000379386	0.678	Lactate dehydrogenase B
12	9606.ENSP00000320171	0.637	Pyruvate kinase PKM
13	9606.ENSP00000263980	0.618	Sodium/hydrogen exchanger 1
14	9606.ENSP00000379057	0.615	Mitochondrial dynamics protein MID49
15	9606.ENSP00000376352	0.613	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
16	9606.ENSP00000290573	0.612	Hexokinase-2
17	9606.ENSP00000445340	0.606	Sodium-coupled monocarboxylate transporter 1
18	9606.ENSP00000406546	0.595	Solute carrier family 23 member 3
19	9606.ENSP00000302289	0.592	Embigin
20	9606.ENSP00000225174	0.568	Peptidyl-prolyl cis-trans isomerase F, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008028	1.000	monocarboxylic acid transmembrane transporter activity
GO:0005515	0.999	protein binding
GO:0022804	0.793	active transmembrane transporter activity
GO:0015291	0.778	secondary active transmembrane transporter activity
GO:0015318	0.633	inorganic molecular entity transmembrane transporter activity
GO:1901702	0.631	salt transmembrane transporter activity
GO:0015075	0.406	monoatomic ion transmembrane transporter activity
GO:0008324	0.339	monoatomic cation transmembrane transporter activity
GO:0022890	0.337	inorganic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046942	0.996	carboxylic acid transport
GO:0015718	0.959	monocarboxylic acid transport
GO:0009987	0.805	cellular process
GO:0008152	0.476	metabolic process
GO:0071704	0.434	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.331	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]