StarFunc result for job id O15379

User Input

>input (428 residues)
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15379	1.000	1.000	9.189E-93	428	1.000	1.000	O15379.pdb.gz	HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens OX=9606 GN=HDAC3 PE=1 SV=2
2	AFDB:Q7KTS4	0.928	0.908	1.028E-67	438	0.666	0.651	Q7KTS4.pdb.gz	Q7KTS4_DROME Histone deacetylase OS=Drosophila melanogaster OX=7227 GN=HDAC3 PE=1 SV=1
3	AFDB:Q8H0W2	0.895	0.899	1.942E-66	426	0.565	0.568	Q8H0W2.pdb.gz	HDA9_ARATH Histone deacetylase 9 OS=Arabidopsis thaliana OX=3702 GN=HDA9 PE=1 SV=1
4	AFDB:O09106	0.933	0.831	2.913E-65	482	0.582	0.517	O09106.pdb.gz	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
5	AFDB:O22446	0.894	0.766	9.790E-64	501	0.561	0.479	O22446.pdb.gz	HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana OX=3702 GN=HDA19 PE=1 SV=2
6	AFDB:A0A2R8QIW0	0.897	0.794	2.071E-63	484	0.605	0.535	A0A2R8QIW0.pdb.gz	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
7	AFDB:Q55BW2	0.892	0.904	1.039E-62	422	0.579	0.588	Q55BW2.pdb.gz	HDA12_DICDI Histone deacetylase B OS=Dictyostelium discoideum OX=44689 GN=hdaB PE=2 SV=1
8	AFDB:P56518	0.902	0.673	1.469E-62	576	0.577	0.429	P56518.pdb.gz	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
9	AFDB:Q94517	0.896	0.740	1.469E-62	521	0.568	0.466	Q94517.pdb.gz	HDAC1_DROME Histone deacetylase HDAC1 OS=Drosophila melanogaster OX=7227 GN=HDAC1 PE=1 SV=2
10	AFDB:Q9FML2	0.892	0.811	3.106E-62	471	0.551	0.501	Q9FML2.pdb.gz	HDA6_ARATH Histone deacetylase 6 OS=Arabidopsis thaliana OX=3702 GN=HDA6 PE=1 SV=1
11	PDB:7zzuB	0.852	0.982	2.028E-58	371	0.540	0.623	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
12	PDB:3sfhA	0.759	0.945	7.059E-41	342	0.332	0.415	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
13	PDB:4qa0A	0.816	0.938	7.494E-40	371	0.350	0.404	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
14	PDB:5g0yB	0.691	0.780	3.456E-25	377	0.206	0.233	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
15	PDB:5eduB	0.686	0.416	2.614E-21	723	0.173	0.102	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
16	PDB:7sggA	0.664	0.450	5.528E-21	644	0.166	0.110	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
17	PDB:6z6fB	0.699	0.463	1.854E-20	661	0.178	0.115	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
18	PDB:5ikkA	0.604	0.445	8.804E-19	594	0.171	0.123	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
19	PDB:6uijA	0.657	0.461	3.313E-18	620	0.164	0.113	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
20	PDB:6ss2AAA	0.317	0.397	1.362E-3	320	0.089	0.119	6ss2AAA.pdb.gz	Structural and functional characterization of C0021158, a high-affinity monoclonal antibody that inhibits Arginase 2 function via a novel non-competitive mechanism of action.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QIW0	535	484	0.582	0.514	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
2	A0A8I6AP99	526	471	0.563	0.512	A0A8I6AP99_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
3	B1WBY8	526	546	0.563	0.441	B1WBY8_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=2 SV=1
4	F7ENH8	527	488	0.563	0.494	F7ENH8_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
5	G5EB64	545	687	0.572	0.357	G5EB64_EMENI histone deacetylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04493 PE=3 SV=1
6	O09106	547	482	0.563	0.500	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
7	O15379	894	428	1.000	1.000	HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens OX=9606 GN=HDAC3 PE=1 SV=2
8	O88895	893	428	0.998	0.998	HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus OX=10090 GN=Hdac3 PE=1 SV=2
9	P32561	516	433	0.558	0.552	RPD3_YEAST Histone deacetylase RPD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPD3 PE=1 SV=1
10	P56517	546	480	0.563	0.502	HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus OX=9031 GN=HDAC1 PE=2 SV=1
11	P56518	524	576	0.563	0.418	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
12	P56520	871	428	0.974	0.974	HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus OX=9031 GN=HDAC3 PE=2 SV=1
13	P70288	526	488	0.563	0.494	HDAC2_MOUSE Histone deacetylase 2 OS=Mus musculus OX=10090 GN=Hdac2 PE=1 SV=1
14	Q13547	547	482	0.563	0.500	HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1
15	Q4QQW4	548	482	0.563	0.500	HDAC1_RAT Histone deacetylase 1 OS=Rattus norvegicus OX=10116 GN=Hdac1 PE=1 SV=1
16	Q4WI19	542	688	0.568	0.353	Q4WI19_ASPFU histone deacetylase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G03390 PE=3 SV=1
17	Q55BW2	538	422	0.582	0.590	HDA12_DICDI Histone deacetylase B OS=Dictyostelium discoideum OX=44689 GN=hdaB PE=2 SV=1
18	Q5ADP0	532	577	0.579	0.430	Q5ADP0_CANAL histone deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPD31 PE=1 SV=1
19	Q6IT96	547	482	0.563	0.500	Q6IT96_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1
20	Q6P6W3	893	428	0.998	0.998	HDAC3_RAT Histone deacetylase 3 OS=Rattus norvegicus OX=10116 GN=Hdac3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	5.6e-80	280.6	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010612174.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010609841.1	0.998	Nuclear receptor corepressor 1
2	885580.XP_010602835.1	0.997	Nuclear receptor corepressor 2
3	885580.XP_010624672.1	0.982	Paired amphipathic helix protein Sin3a
4	885580.XP_010617062.1	0.973	F-box-like/WD repeat-containing protein TBL1X
5	885580.XP_010629804.1	0.962	Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proin [...]
6	885580.XP_010630101.1	0.953	Uncharacterized protein
7	885580.XP_010620272.1	0.952	AT-rich interactive domain-containing protein 4B
8	885580.XP_010639750.1	0.952	AT-rich interactive domain-containing protein 4A
9	885580.XP_010630730.1	0.949	F-box-like/WD repeat-containing protein TBL1XR1
10	885580.XP_010623224.1	0.947	Belongs to the histone H2A family.
11	885580.XP_010613125.1	0.943	G protein pathway suppressor 2
12	885580.XP_010634478.1	0.943	Transcription factor p65
13	885580.XP_010621402.1	0.942	Uncharacterized protein LOC104861624
14	885580.XP_010641185.1	0.937	Myc proto-oncogene protein
15	885580.XP_010607533.1	0.936	Transcriptional repressor protein YY1
16	885580.XP_010613998.1	0.930	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
17	885580.XP_010618274.1	0.928	Inhibitor of growth protein
18	885580.XP_010640579.1	0.926	PHD finger protein 12
19	885580.XP_010612386.1	0.908	Variant histone H2A which replaces conventional H2A in a subset of nucleosomes
20	885580.XP_010619862.1	0.908	Histone deacetylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004407	1.000	histone deacetylase activity
GO:0140297	0.975	DNA-binding transcription factor binding
GO:0140110	0.929	transcription regulator activity
GO:0003712	0.697	transcription coregulator activity
GO:0003714	0.567	transcription corepressor activity
GO:0003676	0.537	nucleic acid binding
GO:0003677	0.507	DNA binding
GO:0043565	0.414	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0048519	0.960	negative regulation of biological process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0010468	0.927	regulation of gene expression
GO:0080090	0.899	regulation of primary metabolic process
GO:0051171	0.898	regulation of nitrogen compound metabolic process
GO:0031323	0.896	regulation of cellular metabolic process
GO:0016043	0.891	cellular component organization
GO:0006325	0.866	chromatin organization
GO:0019219	0.860	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.857	regulation of biosynthetic process
GO:0071704	0.855	organic substance metabolic process
GO:0043170	0.822	macromolecule metabolic process
GO:0031326	0.784	regulation of cellular biosynthetic process
GO:0010556	0.783	regulation of macromolecule biosynthetic process
GO:0044238	0.723	primary metabolic process
GO:0006807	0.693	nitrogen compound metabolic process
GO:0048523	0.680	negative regulation of cellular process
GO:0051252	0.652	regulation of RNA metabolic process
GO:2001141	0.623	regulation of RNA biosynthetic process
GO:0006355	0.614	regulation of DNA-templated transcription
GO:0009892	0.601	negative regulation of metabolic process
GO:0048518	0.529	positive regulation of biological process
GO:0010605	0.527	negative regulation of macromolecule metabolic process
GO:0043412	0.523	macromolecule modification
GO:0050896	0.401	response to stimulus
GO:0048522	0.399	positive regulation of cellular process
GO:1901564	0.357	organonitrogen compound metabolic process
GO:0036211	0.326	protein modification process
GO:0009893	0.325	positive regulation of metabolic process
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0098732	0.313	macromolecule deacylation
GO:0051173	0.308	positive regulation of nitrogen compound metabolic process
GO:0031325	0.301	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.969	protein-containing complex
GO:0043232	0.818	intracellular non-membrane-bounded organelle
GO:0140513	0.818	nuclear protein-containing complex
GO:1902494	0.741	catalytic complex
GO:0000118	0.673	histone deacetylase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]