StarFunc result for job id O15381

User Input

>input (856 residues)
MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVE
KVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMN
SSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPS
VKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDG
EIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRG
VLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCI
IFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL
RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCRE
AAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP
LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAP
VRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESE
RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFI
MAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIA
GDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
KKDQIMYERLQESLSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15381	1.000	1.000	0.000	856	1.000	1.000	O15381.pdb.gz	NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1
2	AFDB:O14325	0.530	0.575	7.770E-72	779	0.428	0.470	O14325.pdb.gz	YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.10c PE=1 SV=1
3	AFDB:Q07844	0.657	0.672	3.723E-70	837	0.398	0.407	Q07844.pdb.gz	RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIX7 PE=1 SV=1
4	AFDB:P54812	0.604	0.637	5.642E-59	810	0.303	0.320	P54812.pdb.gz	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
5	AFDB:Q9SCN8	0.594	0.623	1.504E-58	815	0.296	0.310	Q9SCN8.pdb.gz	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
6	AFDB:O44008	0.603	0.659	3.806E-58	780	0.299	0.328	O44008.pdb.gz	O44008_9TRYP Valosin-containing protein homolog OS=Trypanosoma brucei OX=5691 GN=VCP PE=4 SV=1
7	AFDB:P46462	0.588	0.622	6.713E-58	806	0.313	0.333	P46462.pdb.gz	TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus OX=10116 GN=Vcp PE=1 SV=3
8	AFDB:P90532	0.395	0.422	3.879E-57	793	0.306	0.330	P90532.pdb.gz	P90532_DICDI Cell division cycle protein 48 OS=Dictyostelium discoideum OX=44689 GN=cdcD PE=2 SV=2
9	AFDB:P54811	0.612	0.647	5.566E-57	809	0.301	0.319	P54811.pdb.gz	TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.1 PE=1 SV=1
10	AFDB:Q9P3A7	0.505	0.527	5.861E-57	815	0.294	0.309	Q9P3A7.pdb.gz	CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc48 PE=1 SV=2
11	PDB:7ln6F	0.295	0.353	4.910E-50	714	0.303	0.363	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
12	PDB:7vcsA	0.480	0.527	1.783E-49	766	0.310	0.346	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
13	PDB:6opcB	0.535	0.609	5.101E-48	741	0.298	0.344	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
14	PDB:7z11D	0.502	0.576	1.769E-44	734	0.277	0.323	7z11D.pdb.gz	Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
15	PDB:5ifwB	0.303	0.364	5.795E-44	702	0.297	0.362	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
16	PDB:7mhsE	0.506	0.849	9.708E-44	489	0.289	0.505	7mhsE.pdb.gz	Active conformation of the p97-p47 unfoldase complex.
17	PDB:6opcF	0.439	0.532	1.799E-35	681	0.268	0.336	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
18	PDB:6oaaE	0.449	0.822	2.916E-34	442	0.263	0.509	6oaaE.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
19	PDB:6jq0E	0.430	0.597	9.899E-24	577	0.179	0.265	6jq0E.pdb.gz	Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.
20	PDB:6jq0F	0.381	0.588	1.306E-22	524	0.157	0.256	6jq0F.pdb.gz	Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PND0	0.0	624	827	0.374	0.387	A0A1D8PND0_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIX7 PE=4 SV=1
2	O14325	0.0	652	779	0.398	0.438	YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.10c PE=1 SV=1
3	O15381	0.0	1754	856	1.000	1.000	NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1
4	Q07844	0.0	617	837	0.363	0.372	RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIX7 PE=1 SV=1
5	Q386Y8	0.0	566	706	0.367	0.445	Q386Y8_TRYB2 Vesicular transport protein (CDC48 homologue), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0014 PE=4 SV=1
6	Q9NAG4	0.0	619	813	0.369	0.389	MAC1_CAEEL Protein mac-1 OS=Caenorhabditis elegans OX=6239 GN=mac-1 PE=1 SV=2
7	Q7ZU99	2.80e-159	487	806	0.312	0.331	TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio OX=7955 GN=vcp PE=1 SV=1
8	P90532	5.20e-159	486	793	0.314	0.339	P90532_DICDI Cell division cycle protein 48 OS=Dictyostelium discoideum OX=44689 GN=cdcD PE=2 SV=2
9	P23787	1.56e-158	484	805	0.318	0.338	TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis OX=8355 GN=vcp PE=1 SV=3
10	P46462	1.06e-156	480	806	0.314	0.334	TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus OX=10116 GN=Vcp PE=1 SV=3
11	C9JUP7	1.10e-156	478	761	0.314	0.353	C9JUP7_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=2
12	P55072	1.64e-156	479	806	0.314	0.334	TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4
13	Q01853	1.64e-156	479	806	0.314	0.334	TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus OX=10090 GN=Vcp PE=1 SV=4
14	Q5ZMU9	2.05e-156	479	806	0.313	0.333	Q5ZMU9_CHICK Transitional endoplasmic reticulum ATPase OS=Gallus gallus OX=9031 GN=VCP PE=1 SV=1
15	Q9LZF6	1.64e-155	477	810	0.306	0.323	CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana OX=3702 GN=CDC48E PE=2 SV=2
16	Q7KN62	1.13e-154	474	801	0.308	0.330	TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster OX=7227 GN=TER94 PE=1 SV=1
17	P54812	3.48e-154	474	810	0.307	0.325	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
18	Q9SCN8	5.02e-154	473	815	0.299	0.314	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
19	P54609	8.30e-154	473	809	0.307	0.325	CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana OX=3702 GN=CDC48A PE=1 SV=1
20	Q38B27	2.69e-153	470	780	0.301	0.331	Q38B27_TRYB2 Valosin-containing protein homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1190 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.6e-91	313.9	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	2.6e-05	35.7	AAA domain
3	PF13191 AAA_16	5e-08	45.0	AAA ATPase domain
4	PF13207 AAA_17	0.98	21.3	AAA domain
5	PF13238 AAA_18	0.0038	29.2	AAA domain
6	PF13245 AAA_19	58	15.3	AAA domain
7	PF07724 AAA_2	5.2e-08	44.7	AAA domain (Cdc48 subfamily)
8	PF13401 AAA_22	5.5e-07	41.4	AAA domain
9	PF13479 AAA_24	56	14.9	AAA domain
10	PF13481 AAA_25	1.1	20.3	AAA domain
11	PF13521 AAA_28	0.014	27.1	AAA domain
12	PF07726 AAA_3	0.1	23.9	ATPase family associated with various cellular activities (AAA)
13	PF13604 AAA_30	2.1e+02	13.0	AAA domain
14	PF13671 AAA_33	1.9e-05	36.3	AAA domain
15	PF07728 AAA_5	1.2e-06	40.0	AAA domain (dynein-related subfamily)
16	PF12775 AAA_7	4.5	18.3	P-loop containing dynein motor region
17	PF17862 AAA_lid_3	1.5e-22	90.5	AAA+ lid domain
18	PF00005 ABC_tran	0.044	25.8	ABC transporter
19	PF06745 ATPase	0.033	25.1	KaiC
20	PF01637 ATPase_2	34	15.8	ATPase domain predominantly from Archaea

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281701

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230640	0.994	Superkiller viralicidic activity 2-like 2
2	9606.ENSP00000261015	0.953	Ribosome biogenesis protein WDR12
3	9606.ENSP00000432119	0.949	WD repeat-containing protein 74
4	9606.ENSP00000225298	0.948	U3 small nucleolar RNA-associated protein 18 homolog
5	9606.ENSP00000257829	0.944	RNA cytidine acetyltransferase
6	9606.ENSP00000309572	0.937	Telomerase reverse transcriptase
7	9606.ENSP00000358563	0.934	H/ACA ribonucleoprotein complex subunit 4
8	9606.ENSP00000354040	0.931	Nucleolar GTP-binding protein 1
9	9606.ENSP00000455106	0.924	Ribosome biogenesis protein BOP1
10	9606.ENSP00000262715	0.919	Telomerase protein component 1
11	9606.ENSP00000338573	0.919	Guanine nucleotide-binding protein-like 3-like protein
12	9606.ENSP00000223073	0.917	RNA-binding protein 28
13	9606.ENSP00000396673	0.914	pre-rRNA processing protein FTSJ3
14	9606.ENSP00000274606	0.913	H/ACA ribonucleoprotein complex subunit 2
15	9606.ENSP00000226796	0.910	H/ACA ribonucleoprotein complex subunit 1
16	9606.ENSP00000362153	0.907	Nucleolar GTP-binding protein 2
17	9606.ENSP00000482075	0.907	Prostaglandin E synthase 3
18	9606.ENSP00000324203	0.905	Telomerase Cajal body protein 1
19	9606.ENSP00000332198	0.905	H/ACA ribonucleoprotein complex subunit 3
20	9606.ENSP00000407323	0.905	Probable rRNA-processing protein EBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0044877	0.998	protein-containing complex binding
GO:1901363	0.997	heterocyclic compound binding
GO:0097159	0.997	organic cyclic compound binding
GO:0003723	0.991	RNA binding
GO:0005524	0.988	ATP binding
GO:0043021	0.970	ribonucleoprotein complex binding
GO:0003824	0.927	catalytic activity
GO:0140657	0.774	ATP-dependent activity
GO:0016787	0.604	hydrolase activity
GO:0016887	0.589	ATP hydrolysis activity
GO:1990275	0.420	preribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.977	regulation of biological process
GO:0071704	0.975	organic substance metabolic process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0044238	0.931	primary metabolic process
GO:0043170	0.916	macromolecule metabolic process
GO:0050794	0.914	regulation of cellular process
GO:0006807	0.907	nitrogen compound metabolic process
GO:0044237	0.867	cellular metabolic process
GO:0044085	0.866	cellular component biogenesis
GO:0042254	0.853	ribosome biogenesis
GO:0019222	0.805	regulation of metabolic process
GO:0031323	0.770	regulation of cellular metabolic process
GO:0090304	0.680	nucleic acid metabolic process
GO:0042273	0.665	ribosomal large subunit biogenesis
GO:0048518	0.578	positive regulation of biological process
GO:0010467	0.556	gene expression
GO:0016070	0.551	RNA metabolic process
GO:0060255	0.542	regulation of macromolecule metabolic process
GO:0080090	0.532	regulation of primary metabolic process
GO:0051171	0.532	regulation of nitrogen compound metabolic process
GO:0019219	0.524	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.518	regulation of cellular biosynthetic process
GO:0006396	0.517	RNA processing
GO:0010556	0.514	regulation of macromolecule biosynthetic process
GO:0048522	0.456	positive regulation of cellular process
GO:0010468	0.423	regulation of gene expression
GO:0010604	0.412	positive regulation of macromolecule metabolic process
GO:0034660	0.400	ncRNA metabolic process
GO:0044260	0.393	cellular macromolecule metabolic process
GO:0034470	0.385	ncRNA processing
GO:0016043	0.319	cellular component organization
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	0.998	nucleolus
GO:0005654	0.990	nucleoplasm
GO:0032991	0.977	protein-containing complex
GO:0016020	0.957	membrane
GO:0005737	0.727	cytoplasm
GO:1990904	0.719	ribonucleoprotein complex
GO:0140513	0.683	nuclear protein-containing complex
GO:1902494	0.665	catalytic complex
GO:1905354	0.436	exoribonuclease complex
GO:0000178	0.355	exosome (RNase complex)
GO:0005697	0.352	telomerase holoenzyme complex
GO:0000176	0.312	nuclear exosome (RNase complex)
GO:0005694	0.305	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.604	Hydrolases.
RHEA:13065	0.589	ATP + H2O = ADP + H(+) + phosphate

[back to server]