StarFunc result for job id O15382

User Input

>input (392 residues)
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0QXF9	0.930	0.820	1.909E-82	445	0.952	0.838	M0QXF9.pdb.gz	M0QXF9_HUMAN Branched-chain-amino-acid aminotransferase (Fragment) OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
2	AFDB:O35854	0.955	0.953	1.876E-78	393	0.814	0.812	O35854.pdb.gz	BCAT2_RAT Branched-chain-amino-acid aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bcat2 PE=1 SV=1
3	PDB:1ekfA	0.922	0.989	9.490E-75	365	0.929	0.997	1ekfA.pdb.gz	The structure of human mitochondrial branched-chain aminotransferase.
4	AFDB:P24288	0.918	0.932	1.618E-64	386	0.561	0.570	P24288.pdb.gz	BCAT1_MOUSE Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus OX=10090 GN=Bcat1 PE=1 SV=2
5	AFDB:P54690	0.918	0.876	1.054E-63	411	0.548	0.523	P54690.pdb.gz	BCAT1_RAT Branched-chain-amino-acid aminotransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Bcat1 PE=1 SV=1
6	AFDB:P54687	0.916	0.930	6.471E-63	386	0.551	0.560	P54687.pdb.gz	BCAT1_HUMAN Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3
7	PDB:2abjA	0.906	0.970	3.822E-61	366	0.541	0.579	2abjA.pdb.gz	The design and synthesis of human branched-chain amino acid aminotransferase inhibitors for treatment of neurodegenerative diseases.
8	AFDB:P54688	0.909	0.859	7.595E-56	415	0.467	0.441	P54688.pdb.gz	BCAT_CAEEL Branched-chain-amino-acid aminotransferase, cytosolic OS=Caenorhabditis elegans OX=6239 GN=bcat-1 PE=2 SV=2
9	AFDB:Q9VYD5	0.903	0.800	1.419E-54	443	0.462	0.409	Q9VYD5.pdb.gz	Q9VYD5_DROME Branched-chain-amino-acid aminotransferase OS=Drosophila melanogaster OX=7227 GN=Bcat PE=1 SV=2
10	AFDB:O14370	0.891	0.819	1.869E-50	427	0.426	0.391	O14370.pdb.gz	BCA1_SCHPO Branched-chain-amino-acid aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eca39 PE=1 SV=3
11	AFDB:P47176	0.887	0.924	2.102E-50	376	0.423	0.441	P47176.pdb.gz	BCA2_YEAST Branched-chain-amino-acid aminotransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT2 PE=1 SV=1
12	AFDB:P38891	0.916	0.914	7.188E-50	393	0.408	0.407	P38891.pdb.gz	BCA1_YEAST Branched-chain-amino-acid aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT1 PE=1 SV=1
13	PDB:3dtfA	0.830	0.895	9.135E-39	363	0.337	0.364	3dtfA.pdb.gz	Structural analysis of mycobacterial branched-chain aminotransferase: implications for inhibitor design.
14	PDB:3ht5A	0.799	0.931	1.776E-36	335	0.327	0.382	3ht5A.pdb.gz	The 1.9 A structure of the branched-chain amino-acid transaminase (IlvE) from Mycobacterium tuberculosis.
15	PDB:1i1lA	0.625	0.794	6.125E-21	304	0.199	0.257	1i1lA.pdb.gz	Structures of Escherichia coli branched-chain amino acid aminotransferase and its complexes with 4-methylvalerate and 2-methylleucine: induced fit and substrate recognition of the enzyme.
16	PDB:1a0gB	0.592	0.800	9.618E-17	282	0.140	0.195	1a0gB.pdb.gz	Crystal structures of L201A mutant of D-amino acid aminotransferase at 2.0 A resolution: implication of the structural role of Leu201 in transamination.
17	PDB:6q1qB	0.571	0.762	1.536E-16	286	0.151	0.206	6q1qB.pdb.gz
18	PDB:1i2kA	0.536	0.749	3.928E-13	269	0.120	0.175	1i2kA.pdb.gz	Structure and Mechanism of Escherichia coli Aminodeoxychorismate Lyase
19	PDB:4k6nA	0.357	0.391	5.495E-6	352	0.099	0.111	4k6nA.pdb.gz	Structure and catalytic mechanism of yeast 4-amino-4-deoxychorismate lyase
20	PDB:4dt4A	0.101	0.171	1.550E-1	160	0.054	0.131	4dt4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0QXF9	0.0	769	445	0.952	0.838	M0QXF9_HUMAN Branched-chain-amino-acid aminotransferase (Fragment) OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
2	M0QZ10	0.0	782	405	0.972	0.941	M0QZ10_HUMAN Branched-chain-amino-acid aminotransferase OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=1
3	O15382	0.0	806	392	1.000	1.000	BCAT2_HUMAN Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2 PE=1 SV=2
4	O35854	0.0	671	393	0.814	0.812	BCAT2_RAT Branched-chain-amino-acid aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bcat2 PE=1 SV=1
5	O35855	0.0	684	393	0.837	0.835	BCAT2_MOUSE Branched-chain-amino-acid aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Bcat2 PE=1 SV=2
6	P24288	1.56e-161	460	386	0.556	0.565	BCAT1_MOUSE Branched-chain-amino-acid aminotransferase, cytosolic OS=Mus musculus OX=10090 GN=Bcat1 PE=1 SV=2
7	P54687	3.00e-161	459	386	0.548	0.557	BCAT1_HUMAN Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3
8	P54690	1.00e-160	459	411	0.546	0.521	BCAT1_RAT Branched-chain-amino-acid aminotransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Bcat1 PE=1 SV=1
9	Q9VYD5	6.15e-131	385	443	0.462	0.409	Q9VYD5_DROME Branched-chain-amino-acid aminotransferase OS=Drosophila melanogaster OX=7227 GN=Bcat PE=1 SV=2
10	P54688	4.26e-125	369	415	0.467	0.441	BCAT_CAEEL Branched-chain-amino-acid aminotransferase, cytosolic OS=Caenorhabditis elegans OX=6239 GN=bcat-1 PE=2 SV=2
11	P47176	2.04e-105	317	376	0.431	0.449	BCA2_YEAST Branched-chain-amino-acid aminotransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT2 PE=1 SV=1
12	Q6FK92	1.10e-103	313	371	0.423	0.447	Q6FK92_CANGA Branched-chain-amino-acid aminotransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=BAT2 PE=3 SV=1
13	O14370	5.84e-103	313	427	0.434	0.398	BCA1_SCHPO Branched-chain-amino-acid aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eca39 PE=1 SV=3
14	Q586R0	6.56e-100	303	367	0.418	0.447	Q586R0_TRYB2 Branched-chain amino acid aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.285 PE=3 SV=1
15	P38891	2.61e-99	302	393	0.406	0.405	BCA1_YEAST Branched-chain-amino-acid aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAT1 PE=1 SV=1
16	Q586R1	7.94e-99	300	367	0.406	0.433	Q586R1_TRYB2 Branched-chain amino acid aminotransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.275 PE=3 SV=1
17	P9WQ75	6.83e-73	233	368	0.337	0.359	ILVE_MYCTU Branched-chain-amino-acid aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ilvE PE=1 SV=1
18	A0R066	1.91e-68	222	368	0.334	0.356	ILVE_MYCS2 Branched-chain-amino-acid aminotransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ilvE PE=1 SV=1
19	Q9M401	1.99e-52	182	413	0.286	0.271	BCAT3_ARATH Branched-chain-amino-acid aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BCAT3 PE=1 SV=1
20	Q93Y32	6.87e-47	166	384	0.265	0.271	BCAT1_ARATH Branched-chain-amino-acid aminotransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BCAT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01063 Aminotran_4	8.3e-26	102.8	Amino-transferase class IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269980	0.981	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
2	9606.ENSP00000318351	0.977	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
3	9606.ENSP00000359151	0.963	Dihydrolipoamide branched chain transacylase E2
4	9606.ENSP00000205402	0.935	Dihydrolipoyl dehydrogenase, mitochondrial
5	9606.ENSP00000359976	0.934	Cystathionine gamma-lyase
6	9606.ENSP00000359258	0.932	Glutamate-cysteine ligase modifier subunit
7	9606.ENSP00000229416	0.906	Glutamate-cysteine ligase catalytic subunit
8	9606.ENSP00000385790	0.891	Serine dehydratase-like
9	9606.ENSP00000257549	0.889	L-serine dehydratase/L-threonine deaminase
10	9606.ENSP00000231420	0.825	Alanine--glyoxylate aminotransferase 2, mitochondrial
11	9606.ENSP00000472474	0.813	L-amino-acid oxidase
12	9606.ENSP00000443459	0.811	Branched-chain-amino-acid aminotransferase, cytosolic
13	9606.ENSP00000264954	0.784	GrpE protein homolog 1, mitochondrial
14	9606.ENSP00000306817	0.784	Ribokinase
15	9606.ENSP00000324842	0.774	Acetoacetyl-CoA synthetase
16	9606.ENSP00000325548	0.764	Cytosolic non-specific dipeptidase
17	9606.ENSP00000273920	0.753	Enolase-phosphatase E1
18	9606.ENSP00000216951	0.743	Glutathione synthetase
19	9606.ENSP00000333666	0.736	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
20	9606.ENSP00000362456	0.732	Protein PBDC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004084	1.000	branched-chain-amino-acid transaminase activity
GO:0005515	0.976	protein binding
GO:0097159	0.336	organic cyclic compound binding
GO:1901363	0.334	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0019752	0.989	carboxylic acid metabolic process
GO:0009081	0.981	branched-chain amino acid metabolic process
GO:1901566	0.977	organonitrogen compound biosynthetic process
GO:0044249	0.917	cellular biosynthetic process
GO:0044283	0.790	small molecule biosynthetic process
GO:0046394	0.667	carboxylic acid biosynthetic process
GO:0009082	0.652	branched-chain amino acid biosynthetic process
GO:1901605	0.519	alpha-amino acid metabolic process
GO:0016054	0.514	organic acid catabolic process
GO:0046395	0.480	carboxylic acid catabolic process
GO:1901565	0.351	organonitrogen compound catabolic process
GO:0009063	0.306	amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.985	nucleus
GO:0005654	0.980	nucleoplasm
GO:0005759	0.931	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.42	1.000	branched-chain-amino-acid transaminase.

[back to server]