StarFunc result for job id O15397

User Input

>input (1037 residues)
MDLNRIIQALKGTIDPKLRIAAENELNQSYKIINFAPSLLRIIVSDHVEFPVRQAAAIYL
KNMVTQYWPDREPPPGEAIFPFNIHENDRQQIRDNIVEGIIRSPDLVRVQLTMCLRAIIK
HDFPGHWPGVVDKIDYYLQSQSSASWLGSLLCLYQLVKTYEYKKAEEREPLIIAMQIFLP
RIQQQIVQLLPDSSYYSVLLQKQILKIFYALVQYALPLQLVNNQTMTTWMEIFRTIIDRT
VPPETLHIDEDDRPELVWWKCKKWALHIVARLFERYGSPGNVTKEYFEFSEFFLKTYAVG
IQQVLLKILDQYRQKEYVAPRVLQQAFNYLNQGVVHSITWKQMKPHIQNISEDVIFSVMC
YKDEDEELWQEDPYEYIRMKFDIFEDYASPTTAAQTLLYTAAKKRKEVLPKMMAFCYQIL
TDPNFDPRKKDGALHVIGSLAEILLKKSLFKDQMELFLQNHVFPLLLSNLGYLRARSCWV
LHAFSSLKFHNELNLRNAVELAKKSLIEDKEMPVKVEAALALQSLISNQIQAKEYMKPHV
RPIMQELLHIVRETENDDVTNVIQKMICEYSQEVASIAVDMTQHLAEIFGKVLQSDEYEE
VEDKTVMAMGILHTIDTILTVVEDHKEITQQLENICLRIIDLVLQKHVIEFYEEILSLAY
SLTCHSISPQMWQLLGILYEVFQQDCFEYFTDMMPLLHNYVTIDTDTLLSNAKHLEILFT
MCRKVLCGDAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVQLVLERLTRGVKTSELRT
MCLQVAIAALYYNPDLLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIG
LSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE
ISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQF
FTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFE
NKGVLSAFNFGTVPSNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15397	1.000	1.000	0.000	1037	1.000	1.000	O15397.pdb.gz	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
2	AFDB:O42480	0.930	0.930	4.868E-85	1038	0.632	0.631	O42480.pdb.gz	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
3	AFDB:Q7KIF8	0.892	0.882	9.106E-72	1049	0.491	0.485	Q7KIF8.pdb.gz	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
4	AFDB:F4IRR2	0.837	0.834	1.553E-44	1040	0.286	0.286	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
5	AFDB:O59809	0.832	0.838	6.815E-44	1029	0.267	0.269	O59809.pdb.gz	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
6	AFDB:P46970	0.814	0.806	4.529E-35	1048	0.241	0.239	P46970.pdb.gz	NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD5 PE=1 SV=2
7	AFDB:Q04175	0.731	0.796	1.800E-32	944	0.205	0.226	Q04175.pdb.gz	SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SXM1 PE=1 SV=1
8	AFDB:Q385Z4	0.755	0.661	8.653E-26	1201	0.207	0.179	Q385Z4.pdb.gz	Q385Z4_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1720 PE=4 SV=1
9	AFDB:Q9ZPY7	0.728	0.772	4.891E-23	972	0.170	0.181	Q9ZPY7.pdb.gz	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1
10	AFDB:Q9XZU1	0.695	0.734	8.899E-23	975	0.175	0.186	Q9XZU1.pdb.gz	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
11	PDB:6n88A	0.372	0.555	3.778E-21	619	0.389	0.651	6n88A.pdb.gz
12	PDB:6n1zA	0.537	0.571	1.109E-19	961	0.149	0.161	6n1zA.pdb.gz
13	PDB:1wa5C	0.664	0.717	5.223E-19	950	0.166	0.181	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
14	PDB:1z3hB	0.611	0.679	1.935E-16	914	0.162	0.184	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
15	PDB:6fvbA	0.626	0.645	3.123E-15	1001	0.149	0.155	6fvbA.pdb.gz
16	PDB:6ahoA	0.566	0.628	1.216E-13	916	0.136	0.154	6ahoA.pdb.gz
17	PDB:1qgkA	0.521	0.603	7.321E-13	876	0.122	0.145	1qgkA.pdb.gz
18	PDB:3nd2A	0.517	0.607	1.286E-12	861	0.112	0.135	3nd2A.pdb.gz
19	PDB:4jlqA	0.430	0.512	1.380E-12	840	0.127	0.157	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
20	PDB:6xu2A	0.372	0.357	2.150E-11	1091	0.155	0.148	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15397	0.0	2150	1037	1.000	1.000	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
2	O42480	0.0	1342	1038	0.633	0.632	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
3	O95373	0.0	1367	1038	0.644	0.644	IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1
4	Q7KIF8	0.0	1016	1049	0.490	0.484	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
5	Q86NK4	0.0	1017	1049	0.490	0.484	Q86NK4_DROME GH01576p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
6	Q95RH0	0.0	631	702	0.312	0.462	Q95RH0_DROME LD30157p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
7	Q9EPL8	0.0	1367	1038	0.643	0.643	IPO7_MOUSE Importin-7 OS=Mus musculus OX=10090 GN=Ipo7 PE=1 SV=2
8	Q9VSD6	0.0	1019	1049	0.491	0.485	Q9VSD6_DROME D-Importin 7/RanBP7 OS=Drosophila melanogaster OX=7227 GN=msk PE=1 SV=1
9	F4IRR2	1.37e-124	407	1040	0.284	0.284	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
10	O59809	1.36e-116	385	1029	0.283	0.285	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
11	P46970	7.61e-72	261	1048	0.261	0.259	NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD5 PE=1 SV=2
12	Q04175	3.82e-47	185	944	0.224	0.246	SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SXM1 PE=1 SV=1
13	Q385Z4	5.04e-23	108	1201	0.168	0.145	Q385Z4_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1720 PE=4 SV=1
14	Q9XZU1	1.09e-13	78.2	975	0.105	0.112	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
15	Q9ERK4	1.22e-12	74.7	971	0.188	0.201	XPO2_MOUSE Exportin-2 OS=Mus musculus OX=10090 GN=Cse1l PE=1 SV=1
16	A0A384NKW7	2.56e-12	73.6	971	0.188	0.201	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
17	P55060	2.56e-12	73.6	971	0.188	0.201	XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3
18	P33307	2.96e-11	70.1	960	0.182	0.197	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2
19	O13671	4.44e-09	63.2	967	0.078	0.084	CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap109 PE=3 SV=2
20	Q9ZPY7	8.56e-09	62.4	972	0.098	0.105	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08506 Cse1	0.0022	28.5	Cse1
2	PF03810 IBN_N	1.7e-17	74.4	Importin-beta N-terminal domain
3	PF10363 RTP1_C1	2.3e+02	13.3	Required for nuclear transport of RNA pol II C-terminus 1
4	PF08389 Xpo1	5.9e+02	11.9	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256079

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.966	Protein argonaute-2
2	9606.ENSP00000373312	0.956	Protein SEC13 homolog
3	9606.ENSP00000352400	0.942	Nuclear pore complex protein Nup214
4	9606.ENSP00000245544	0.938	Nuclear pore complex protein Nup85
5	9606.ENSP00000354742	0.938	Importin-9
6	9606.ENSP00000444029	0.936	Nuclear pore complex protein Nup153
7	9606.ENSP00000310668	0.934	Nuclear pore complex protein Nup93
8	9606.ENSP00000316032	0.934	Nuclear pore complex protein Nup98-Nup96
9	9606.ENSP00000345895	0.932	Nuclear pore complex protein Nup50
10	9606.ENSP00000229179	0.931	Nuclear pore complex protein Nup107
11	9606.ENSP00000458954	0.931	Nuclear pore complex protein Nup88
12	9606.ENSP00000285968	0.929	Nuclear pore complex protein Nup205
13	9606.ENSP00000290158	0.929	Importin subunit beta-1
14	9606.ENSP00000471191	0.928	Nuclear pore glycoprotein p62
15	9606.ENSP00000231498	0.926	Nuclear pore complex protein Nup155
16	9606.ENSP00000261396	0.925	Nuclear pore complex protein Nup133
17	9606.ENSP00000283195	0.922	E3 SUMO-protein ligase RanBP2
18	9606.ENSP00000356448	0.922	Nucleoprotein TPR
19	9606.ENSP00000367721	0.922	Nuclear pore complex protein Nup160
20	9606.ENSP00000379182	0.915	mRNA export factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.791	enzyme binding
GO:0031267	0.727	small GTPase binding
GO:0097159	0.581	organic cyclic compound binding
GO:0003723	0.503	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.936	regulation of biological process
GO:0050794	0.931	regulation of cellular process
GO:0006913	0.726	nucleocytoplasmic transport
GO:0071705	0.671	nitrogen compound transport
GO:0033036	0.660	macromolecule localization
GO:0071702	0.658	organic substance transport
GO:0023052	0.598	signaling
GO:0050896	0.577	response to stimulus
GO:0015031	0.505	protein transport
GO:0006886	0.502	intracellular protein transport
GO:0007154	0.491	cell communication
GO:0006606	0.466	protein import into nucleus
GO:0051716	0.436	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0005635	0.748	nuclear envelope
GO:0043232	0.463	intracellular non-membrane-bounded organelle
GO:0016020	0.387	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]