StarFunc result for job id O15399

User Input

>input (1336 residues)
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZSK1	0.589	0.544	0.000	1451	0.400	0.369	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
2	AFDB:O15399	1.000	1.000	0.000	1336	1.000	1.000	O15399.pdb.gz	NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens OX=9606 GN=GRIN2D PE=1 SV=2
3	AFDB:P35436	0.584	0.535	0.000	1464	0.430	0.392	P35436.pdb.gz	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
4	PDB:4tllA	0.227	0.380	2.110E-49	767	0.142	0.248	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
5	PDB:4pe5C	0.226	0.385	1.730E-48	754	0.155	0.275	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
6	PDB:7ocaA	0.202	0.318	4.909E-46	775	0.141	0.243	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
7	PDB:4tlmC	0.237	0.405	6.126E-46	750	0.141	0.252	4tlmC.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
8	PDB:5iouA	0.220	0.347	1.361E-44	803	0.152	0.253	5iouA.pdb.gz	Mechanism of NMDA Receptor Inhibition and Activation.
9	PDB:7rzaA	0.213	0.275	1.738E-43	981	0.129	0.176	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
10	PDB:7rz4A	0.213	0.272	3.196E-43	993	0.130	0.175	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
11	PDB:5weoA	0.213	0.274	6.357E-42	988	0.133	0.180	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
12	PDB:5idfB	0.207	0.348	3.167E-41	734	0.124	0.226	5idfB.pdb.gz
13	PDB:4u1xC	0.217	0.351	8.308E-40	755	0.125	0.221	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
14	AFDB:Q99PJ1	0.030	0.024	7.001E-2	1943	0.077	0.053	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
15	AFDB:P48681	0.036	0.030	2.367E-1	1621	0.103	0.085	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
16	AFDB:Q5AKX6	0.031	0.050	2.644E-1	591	0.055	0.125	Q5AKX6.pdb.gz	Q5AKX6_CANAL Cup2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CUP2 PE=4 SV=1
17	AFDB:Q5AMH6	0.035	0.049	2.644E-1	821	0.057	0.093	Q5AMH6.pdb.gz	CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAS5 PE=4 SV=1
18	AFDB:A0A2R8QJD2	0.042	0.061	2.954E-1	644	0.077	0.160	A0A2R8QJD2.pdb.gz
19	AFDB:Q9W213	0.036	0.034	3.896E-1	1395	0.062	0.059	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
20	AFDB:Q8IXK0	0.028	0.041	7.573E-1	858	0.071	0.111	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7XY94	0.0	976	1448	0.349	0.322	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
2	B7ZSK1	0.0	1030	1451	0.367	0.338	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
3	G1TPJ8	0.0	1540	888	0.560	0.842	G1TPJ8_RABIT Glutamate receptor OS=Oryctolagus cuniculus OX=9986 GN=GRIN2D PE=3 SV=2
4	O15399	0.0	2680	1336	1.000	1.000	NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens OX=9606 GN=GRIN2D PE=1 SV=2
5	P35436	0.0	1024	1464	0.371	0.338	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
6	Q00959	0.0	1020	1464	0.360	0.329	NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2
7	Q00960	0.0	976	1482	0.347	0.312	NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus OX=10116 GN=Grin2b PE=1 SV=1
8	Q00961	0.0	1090	1237	0.448	0.484	NMDE3_RAT Glutamate receptor ionotropic, NMDA 2C OS=Rattus norvegicus OX=10116 GN=Grin2c PE=1 SV=1
9	Q01097	0.0	973	1482	0.346	0.312	NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3
10	Q01098	0.0	1107	1239	0.444	0.479	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
11	Q03391	0.0	2571	1323	0.966	0.976	NMDE4_MOUSE Glutamate receptor ionotropic, NMDA 2D OS=Mus musculus OX=10090 GN=Grin2d PE=1 SV=3
12	Q12879	0.0	1016	1464	0.366	0.334	NMDE1_HUMAN Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1
13	Q13224	0.0	978	1484	0.347	0.313	NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens OX=9606 GN=GRIN2B PE=1 SV=3
14	Q14957	0.0	1103	1233	0.419	0.454	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
15	Q61984	0.0	977	1203	0.367	0.407	Q61984_MOUSE Glutamate receptor OS=Mus musculus OX=10090 GN=NMDA2C PE=3 SV=1
16	Q62645	0.0	2565	1323	0.962	0.971	NMDE4_RAT Glutamate receptor ionotropic, NMDA 2D OS=Rattus norvegicus OX=10116 GN=Grin2d PE=1 SV=2
17	Q6IWN7	7.64e-127	421	1070	0.190	0.237	Q6IWN7_DROME NMDA receptor 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
18	Q8MM14	1.15e-126	416	902	0.185	0.274	Q8MM14_DROME Glutamate NMDA receptor subunit variant NR2-a OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
19	Q9W581	1.16e-126	421	1083	0.190	0.235	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
20	E1JJC6	1.41e-126	417	941	0.191	0.271	E1JJC6_DROME NMDA receptor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	5e-11	54.0	Receptor family ligand binding region
2	PF00060 Lig_chan	3e-30	116.5	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	1.9e-25	100.6	Ligated ion channel L-glutamate- and glycine-binding site
4	PF01554 MatE	3.9e+02	12.1	MatE
5	PF10565 NMDAR2_C	3.2e+02	11.6	N-methyl D-aspartate receptor 2B3 C-terminus
6	PF00497 SBP_bac_3	5.1e-20	83.4	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263269

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.972	Disks large homolog 4
2	9606.ENSP00000360608	0.963	Glutamate receptor ionotropic, NMDA 1
3	9606.ENSP00000355155	0.935	Glutamate receptor ionotropic, NMDA 3A
4	9606.ENSP00000296526	0.931	Glutamate receptor 2
5	9606.ENSP00000407586	0.927	GTPase HRas
6	9606.ENSP00000362680	0.920	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000256078	0.915	GTPase KRas
8	9606.ENSP00000358548	0.912	GTPase NRas
9	9606.ENSP00000379818	0.911	Glutamate receptor ionotropic, NMDA 2A
10	9606.ENSP00000477455	0.911	Glutamate receptor ionotropic, NMDA 2B
11	9606.ENSP00000293190	0.908	Glutamate receptor ionotropic, NMDA 2C
12	9606.ENSP00000477999	0.872	Nitric oxide synthase, brain
13	9606.ENSP00000440185	0.833	Proenkephalin-B
14	9606.ENSP00000428994	0.828	Glutamate receptor 1
15	9606.ENSP00000300105	0.823	Voltage-dependent calcium channel gamma-2 subunit
16	9606.ENSP00000225328	0.820	P2X purinoceptor 5
17	9606.ENSP00000263314	0.820	P2X purinoceptor 3
18	9606.ENSP00000337675	0.819	Receptor-binding cancer antigen expressed on SiSo cells
19	9606.ENSP00000416193	0.819	P2X purinoceptor 6
20	9606.ENSP00000225538	0.818	P2X purinoceptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005261	0.999	monoatomic cation channel activity
GO:0004972	0.999	NMDA glutamate receptor activity
GO:1901702	0.996	salt transmembrane transporter activity
GO:0046873	0.996	metal ion transmembrane transporter activity
GO:0005262	0.983	calcium channel activity
GO:0099094	0.980	ligand-gated monoatomic cation channel activity
GO:0099604	0.960	ligand-gated calcium channel activity
GO:0022849	0.691	glutamate-gated calcium ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050896	0.993	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0007166	0.967	cell surface receptor signaling pathway
GO:0032501	0.953	multicellular organismal process
GO:0055085	0.938	transmembrane transport
GO:0006811	0.930	monoatomic ion transport
GO:0044057	0.884	regulation of system process
GO:0007215	0.821	glutamate receptor signaling pathway
GO:0050877	0.787	nervous system process
GO:0098660	0.787	inorganic ion transmembrane transport
GO:0031644	0.782	regulation of nervous system process
GO:0034220	0.771	monoatomic ion transmembrane transport
GO:0010646	0.757	regulation of cell communication
GO:0098655	0.723	monoatomic cation transmembrane transport
GO:0065008	0.710	regulation of biological quality
GO:0032879	0.706	regulation of localization
GO:0006816	0.688	calcium ion transport
GO:0048518	0.684	positive regulation of biological process
GO:0070588	0.683	calcium ion transmembrane transport
GO:0097553	0.637	calcium ion transmembrane import into cytosol
GO:0023051	0.566	regulation of signaling
GO:0042391	0.510	regulation of membrane potential
GO:0048522	0.501	positive regulation of cellular process
GO:0051049	0.419	regulation of transport
GO:0050905	0.374	neuromuscular process
GO:0007268	0.340	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0030054	0.997	cell junction
GO:0031090	0.997	organelle membrane
GO:0098796	0.996	membrane protein complex
GO:0045202	0.990	synapse
GO:0005789	0.988	endoplasmic reticulum membrane
GO:0034702	0.986	ion channel complex
GO:0098802	0.985	plasma membrane signaling receptor complex
GO:0017146	0.977	NMDA selective glutamate receptor complex
GO:0098590	0.711	plasma membrane region
GO:0097060	0.587	synaptic membrane
GO:0098978	0.489	glutamatergic synapse
GO:0098794	0.485	postsynapse
GO:0098793	0.446	presynapse
GO:0014069	0.415	postsynaptic density
GO:0045211	0.395	postsynaptic membrane
GO:0042734	0.330	presynaptic membrane
GO:0098839	0.321	postsynaptic density membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.984	Ca(2+)(in) = Ca(2+)(out)

[back to server]