StarFunc result for job id O15405

User Input

>input (576 residues)
MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLG
DEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISR
NLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQS
QLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKK
PKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ
KQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNT
PLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQ
HFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQI
TSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7SBD2	0.418	0.417	1.249E-70	577	0.955	0.953	B7SBD2.pdb.gz	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
2	AFDB:O94900	0.187	0.204	5.916E-24	526	0.392	0.430	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
3	AFDB:B7WNT5	0.111	0.131	1.233E-5	481	0.142	0.170	B7WNT5.pdb.gz	B7WNT5_HUMAN Transcription factor 7 OS=Homo sapiens OX=9606 GN=TCF7 PE=1 SV=1
4	PDB:1j5nA	0.123	0.607	6.437E-5	93	0.057	0.355	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
5	AFDB:O94818	0.086	0.080	4.492E-4	638	0.108	0.097	O94818.pdb.gz	NOL4_HUMAN Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL4 PE=1 SV=2
6	AFDB:Q5VR96	0.073	0.090	1.967E-3	437	0.109	0.144	Q5VR96.pdb.gz	Q5VR96_ORYSJ Os06g0275600 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0275600 PE=3 SV=1
7	AFDB:Q6QDP7	0.096	0.105	1.967E-3	521	0.106	0.117	Q6QDP7.pdb.gz	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
8	AFDB:F1Q7T6	0.120	0.114	3.082E-3	610	0.134	0.126	F1Q7T6.pdb.gz
9	AFDB:R9PY21	0.096	0.081	3.985E-3	720	0.215	0.172	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
10	AFDB:O18400	0.078	0.086	4.831E-3	509	0.122	0.138	O18400.pdb.gz	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
11	AFDB:U3JAG9	0.095	0.056	5.857E-3	1113	0.111	0.058	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
12	PDB:7ploI	0.081	0.103	7.578E-1	451	0.014	0.018	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:4n78F	0.107	0.328	1.114	156	0.026	0.096	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:6tedR	0.071	0.147	1.862	244	0.026	0.061	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	PDB:4i9qB	0.062	0.044	3.318	873	0.010	0.007	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
16	PDB:7eebB	0.077	0.141	3.538	281	0.026	0.053	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
17	PDB:1kw2A	0.057	0.071	4.289	455	0.014	0.018	1kw2A.pdb.gz
18	PDB:2b5uA	0.100	0.121	4.289	470	0.031	0.038	2b5uA.pdb.gz
19	PDB:2pe4A	0.045	0.061	4.877	417	0.007	0.010	2pe4A.pdb.gz
20	PDB:3j79T	0.075	0.175	4.877	181	0.017	0.055	3j79T.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7SBD2	0.0	760	577	0.922	0.920	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
2	O15405	0.0	1149	576	1.000	1.000	TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=2
3	Q80W03	0.0	721	575	0.724	0.725	TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus OX=10090 GN=Tox3 PE=1 SV=1
4	H3BTZ9	7.42e-115	340	166	0.288	1.000	H3BTZ9_HUMAN TOX high mobility group box family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=1
5	O94900	3.03e-98	310	526	0.385	0.422	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
6	Q66JW3	1.83e-96	306	526	0.382	0.418	TOX_MOUSE Thymocyte selection-associated high mobility group box protein TOX OS=Mus musculus OX=10090 GN=Tox PE=1 SV=2
7	O94842	2.88e-90	292	621	0.304	0.282	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
8	Q76IQ7	3.81e-62	214	473	0.286	0.349	TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus OX=10116 GN=Tox2 PE=2 SV=1
9	Q96NM4	2.40e-42	160	488	0.247	0.291	TOX2_HUMAN TOX high mobility group box family member 2 OS=Homo sapiens OX=9606 GN=TOX2 PE=1 SV=2
10	P11633	4.06e-14	70.5	99	0.066	0.384	NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6B PE=1 SV=3
11	B4UN11	4.06e-13	67.4	93	0.052	0.323	B4UN11_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08541g PE=4 SV=1
12	Q9Z104	2.05e-12	70.5	317	0.076	0.139	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
13	Q08943	2.46e-12	72.0	708	0.061	0.049	SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus OX=10090 GN=Ssrp1 PE=1 SV=2
14	Q9W602	3.20e-12	71.6	693	0.057	0.048	SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis OX=8355 GN=ssrp1 PE=1 SV=1
15	P07746	6.46e-12	67.4	204	0.057	0.162	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
16	F2Z594	1.56e-11	66.6	220	0.068	0.177	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
17	P09429	1.77e-11	66.2	215	0.062	0.167	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
18	P10103	1.77e-11	66.2	215	0.062	0.167	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
19	P63158	1.77e-11	66.2	215	0.062	0.167	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
20	P63159	1.77e-11	66.2	215	0.062	0.167	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	1.4e-14	65.6	HMG (high mobility group) box
2	PF09011 HMG_box_2	2.7e-08	45.6	HMG-box domain
3	PF15761 IMUP	50	16.0	Immortalisation up-regulated protein
4	PF04690 YABBY	2e+02	13.9	YABBY protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371194	0.856	Lymphocyte-specific protein 1
2	9606.ENSP00000401764	0.788	Cbp/p300-interacting transactivator 1
3	9606.ENSP00000382423	0.761	Mitogen-activated protein kinase kinase kinase 1
4	9606.ENSP00000410294	0.756	Fibroblast growth factor receptor 2
5	9606.ENSP00000343200	0.753	SKI family transcriptional corepressor 1
6	9606.ENSP00000362727	0.736	DENN domain-containing protein 1A
7	9606.ENSP00000370593	0.733	Receptor-type tyrosine-protein phosphatase delta
8	9606.ENSP00000418751	0.713	BTB/POZ domain-containing protein 9
9	9606.ENSP00000385995	0.709	Thyroid adenoma-associated protein
10	9606.ENSP00000424328	0.687	Mitochondrial ribosomal protein S30
11	9606.ENSP00000377668	0.685	Sulfite oxidase, mitochondrial
12	9606.ENSP00000295736	0.684	Sodium bicarbonate cotransporter 3
13	9606.ENSP00000364464	0.679	Aminopeptidase O
14	9606.ENSP00000419471	0.665	DNA repair protein RAD51 homolog 2
15	9606.ENSP00000229214	0.663	KRR1 small subunit processome component homolog
16	9606.ENSP00000299335	0.651	Cytochrome c oxidase assembly protein COX11, mitochondrial
17	9606.ENSP00000478927	0.645	Transcriptional coactivator YAP1
18	9606.ENSP00000343847	0.633	Serine/threonine-protein kinase Nek10
19	9606.ENSP00000178640	0.627	Dual specificity mitogen-activated protein kinase kinase 5
20	9606.ENSP00000418960	0.614	Breast cancer type 1 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.600	nucleic acid binding
GO:0003677	0.539	DNA binding
GO:0140110	0.329	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.986	positive regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0045935	0.958	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.935	positive regulation of DNA-templated transcription
GO:0009987	0.877	cellular process
GO:0048519	0.739	negative regulation of biological process
GO:0048523	0.720	negative regulation of cellular process
GO:0050896	0.714	response to stimulus
GO:0051716	0.656	cellular response to stimulus
GO:0007165	0.551	signal transduction
GO:0006357	0.426	regulation of transcription by RNA polymerase II
GO:0010941	0.400	regulation of cell death
GO:0045944	0.335	positive regulation of transcription by RNA polymerase II
GO:0043069	0.331	negative regulation of programmed cell death
GO:0043066	0.308	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]