StarFunc result for job id O15409

User Input

>input (715 residues)
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQHPGKQAKEQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQG
LISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTT
SSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKWPGCESICEDF
GQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP
KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHS
DKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAY
FRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPT
SLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSP
GCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15409	1.000	1.000	1.762E-102	715	1.000	1.000	O15409.pdb.gz	FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2 PE=1 SV=2
2	AFDB:Q4JNX5	0.217	0.222	2.089E-82	697	0.806	0.826	Q4JNX5.pdb.gz	Q4JNX5_DANRE Forkhead box P2 OS=Danio rerio OX=7955 GN=foxp2 PE=2 SV=1
3	AFDB:Q498D1	0.162	0.163	2.223E-68	711	0.646	0.650	Q498D1.pdb.gz	FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1
4	AFDB:Q5W1J5	0.265	0.317	5.312E-62	578	0.580	0.718	Q5W1J5.pdb.gz	FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis OX=8355 GN=foxp1 PE=1 SV=1
5	AFDB:Q6U8D7	0.195	0.294	7.955E-22	431	0.187	0.311	Q6U8D7.pdb.gz	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1
6	AFDB:D2EAB6	0.133	0.338	2.129E-14	278	0.129	0.331	D2EAB6.pdb.gz
7	AFDB:P40466	0.117	0.169	4.001E-9	484	0.102	0.151	P40466.pdb.gz	FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKH1 PE=1 SV=1
8	AFDB:D4A1T1	0.114	0.170	5.159E-9	474	0.126	0.190	D4A1T1.pdb.gz	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
9	AFDB:Q9DEN3	0.116	0.218	6.243E-9	371	0.081	0.156	Q9DEN3.pdb.gz	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
10	AFDB:A0A0R4IJS9	0.113	0.249	1.620E-8	312	0.083	0.189	A0A0R4IJS9.pdb.gz	A0A0R4IJS9_DANRE Forkhead box Q1a OS=Danio rerio OX=7955 GN=foxq1l PE=4 SV=1
11	PDB:3m8eA	0.083	0.436	4.030E-2	101	0.017	0.119	3m8eA.pdb.gz
12	PDB:1xsdA	0.103	0.425	4.877E-2	125	0.017	0.096	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
13	PDB:4yrvA	0.080	0.166	4.877E-2	288	0.024	0.059	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
14	PDB:7k5yU	0.091	0.645	6.289E-2	75	0.017	0.160	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
15	PDB:4zzlA	0.086	0.342	6.702E-2	146	0.028	0.137	4zzlA.pdb.gz
16	PDB:5hs7A	0.081	0.461	7.611E-2	102	0.015	0.108	5hs7A.pdb.gz
17	PDB:3euhB	0.098	0.202	9.211E-2	321	0.020	0.044	3euhB.pdb.gz
18	PDB:6qpqD	0.085	0.505	9.211E-2	82	0.011	0.098	6qpqD.pdb.gz
19	PDB:3euhC	0.090	0.260	1.046E-1	206	0.021	0.073	3euhC.pdb.gz
20	PDB:1z9cC	0.084	0.353	1.115E-1	138	0.022	0.116	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K4EPC4	0.0	1408	711	0.982	0.987	K4EPC4_TAEGU Transcription factor FoxP2 (Fragment) OS=Taeniopygia guttata OX=59729 GN=foxp2 PE=2 SV=1
2	O15409	0.0	1439	715	1.000	1.000	FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2 PE=1 SV=2
3	P0CF24	0.0	1410	710	0.987	0.994	FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus OX=10116 GN=Foxp2 PE=3 SV=1
4	P58462	0.0	652	705	0.617	0.626	FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus OX=10090 GN=Foxp1 PE=1 SV=1
5	P58463	0.0	1426	714	0.994	0.996	FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus OX=10090 GN=Foxp2 PE=1 SV=2
6	Q498D1	0.0	659	711	0.618	0.622	FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1
7	Q4JNX5	0.0	867	697	0.771	0.791	Q4JNX5_DANRE Forkhead box P2 OS=Danio rerio OX=7955 GN=foxp2 PE=2 SV=1
8	Q58NQ4	0.0	611	686	0.436	0.455	FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus OX=9031 GN=FOXP1 PE=2 SV=1
9	Q5W1J5	0.0	614	578	0.538	0.666	FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis OX=8355 GN=foxp1 PE=1 SV=1
10	Q6QBA5	0.0	1412	711	0.985	0.990	Q6QBA5_TAEGU Forkhead box P2 isoform I OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
11	Q6TKS2	0.0	1407	709	0.980	0.989	Q6TKS2_TAEGU Forkhead box P2 OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
12	Q8IVH2	0.0	555	680	0.399	0.419	FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens OX=9606 GN=FOXP4 PE=1 SV=1
13	Q9DBY0	0.0	551	795	0.411	0.370	FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus OX=10090 GN=Foxp4 PE=1 SV=1
14	Q9H334	0.0	679	677	0.618	0.653	FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1 PE=1 SV=1
15	Q9VH87	2.51e-90	291	442	0.213	0.344	Q9VH87_DROME Forkhead box P, isoform D OS=Drosophila melanogaster OX=7227 GN=FoxP PE=2 SV=2
16	A0A0B4K6N2	2.08e-79	265	520	0.187	0.258	A0A0B4K6N2_DROME Forkhead box P, isoform C OS=Drosophila melanogaster OX=7227 GN=FoxP PE=4 SV=1
17	D3ZKI1	1.29e-69	234	394	0.178	0.322	D3ZKI1_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=4 SV=2
18	D4Q8I1	2.34e-69	235	429	0.178	0.296	D4Q8I1_RAT Forkhead box P3 (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=2 SV=1
19	D4Q8I2	5.71e-69	236	488	0.178	0.260	D4Q8I2_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=2 SV=1
20	Q99JB6	4.62e-68	232	429	0.175	0.291	FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus OX=10090 GN=Foxp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06213 CobT	8.7e+02	10.7	Cobalamin biosynthesis protein CobT
2	PF00250 Forkhead	2.5e-24	96.6	Forkhead domain
3	PF16159 FOXP-CC	1.3e-31	120.2	FOXP coiled-coil domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033573

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000051373	0.881	Probable role in mitotic spindle regulation and coordination of mitotic processes. May have a preferential role in regulating neurogenesis (By similarity)
2	9598.ENSPTRP00000047128	0.865	Uncharacterized protein
3	9598.ENSPTRP00000034175	0.837	Implicated in chromosome condensation and DNA damage induced cellular responses. May play a role in neurogenesis and regulation of the size of the cerebral cortex (By similarity)
4	9598.ENSPTRP00000000612	0.805	Uncharacterized protein
5	9598.ENSPTRP00000053767	0.805	C-terminal binding protein 1
6	9598.ENSPTRP00000046292	0.771	Uncharacterized protein
7	9598.ENSPTRP00000050159	0.758	Uncharacterized protein
8	9598.ENSPTRP00000026070	0.746	Forkhead box P1
9	9598.ENSPTRP00000033441	0.701	Cut-like homeobox 1
10	9598.ENSPTRP00000042880	0.695	Uncharacterized protein
11	9598.ENSPTRP00000020307	0.693	POU domain protein
12	9598.ENSPTRP00000037587	0.689	Uncharacterized protein
13	9598.ENSPTRP00000037999	0.683	Pan troglodytes sushi-repeat containing protein, X-linked 2 (SRPX2), mRNA
14	9598.ENSPTRP00000039894	0.650	Uncharacterized protein
15	9598.ENSPTRP00000005353	0.631	C-terminal binding protein 2
16	9598.ENSPTRP00000051245	0.631	SLIT-ROBO Rho GTPase activating protein 2
17	9598.ENSPTRP00000028353	0.625	F-box and WD repeat domain containing 7
18	9598.ENSPTRP00000052505	0.614	B-cell CLL/lymphoma 11B (zinc finger protein)
19	9598.ENSPTRP00000012805	0.600	Uncharacterized protein
20	9598.ENSPTRP00000037451	0.594	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0008134	0.999	transcription factor binding
GO:0001046	0.996	core promoter sequence-specific DNA binding
GO:0042802	0.991	identical protein binding
GO:0042803	0.893	protein homodimerization activity
GO:0000981	0.832	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.765	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.605	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.541	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.485	DNA-binding transcription activator activity
GO:0001228	0.484	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.996	multicellular organism development
GO:0050896	0.993	response to stimulus
GO:0030154	0.993	cell differentiation
GO:0048731	0.993	system development
GO:0050794	0.988	regulation of cellular process
GO:0030182	0.979	neuron differentiation
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0048518	0.963	positive regulation of biological process
GO:0009605	0.962	response to external stimulus
GO:0010468	0.956	regulation of gene expression
GO:0007610	0.935	behavior
GO:0048513	0.933	animal organ development
GO:0009653	0.923	anatomical structure morphogenesis
GO:0071840	0.887	cellular component organization or biogenesis
GO:0016043	0.881	cellular component organization
GO:0048468	0.873	cell development
GO:0031323	0.866	regulation of cellular metabolic process
GO:0080090	0.860	regulation of primary metabolic process
GO:0031175	0.850	neuron projection development
GO:0051171	0.849	regulation of nitrogen compound metabolic process
GO:0048519	0.846	negative regulation of biological process
GO:0009612	0.842	response to mechanical stimulus
GO:0016358	0.828	dendrite development
GO:0048523	0.823	negative regulation of cellular process
GO:0019219	0.822	regulation of nucleobase-containing compound metabolic process
GO:0050877	0.819	nervous system process
GO:0060996	0.787	dendritic spine development
GO:0031326	0.776	regulation of cellular biosynthetic process
GO:0010556	0.775	regulation of macromolecule biosynthetic process
GO:0051252	0.775	regulation of RNA metabolic process
GO:0006355	0.773	regulation of DNA-templated transcription
GO:0048522	0.771	positive regulation of cellular process
GO:0050890	0.752	cognition
GO:0007417	0.739	central nervous system development
GO:0007420	0.670	brain development
GO:0007638	0.666	mechanosensory behavior
GO:0007612	0.662	learning
GO:0030900	0.640	forebrain development
GO:0009892	0.635	negative regulation of metabolic process
GO:0010605	0.633	negative regulation of macromolecule metabolic process
GO:0010996	0.593	response to auditory stimulus
GO:0045934	0.516	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.513	negative regulation of DNA-templated transcription
GO:0021537	0.502	telencephalon development
GO:0010604	0.476	positive regulation of macromolecule metabolic process
GO:0042221	0.430	response to chemical
GO:0006357	0.371	regulation of transcription by RNA polymerase II
GO:0051239	0.352	regulation of multicellular organismal process
GO:0023051	0.336	regulation of signaling
GO:0010646	0.336	regulation of cell communication
GO:0009888	0.324	tissue development
GO:0050793	0.318	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0044297	0.638	cell body
GO:0005737	0.439	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]