StarFunc result for job id O15438

User Input

>input (1527 residues)
MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHC
RGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLAT
LLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFAL
VLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDL
WSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFL
KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCS
MMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQ
MKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWM
CSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLK
RIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVV
GPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRY
QQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSA
VDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQ
KQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW
DYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGI
LQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVD
EVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLE
SVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVE
FVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVG
IVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTL
RMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARAL
LRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGV
VAEFDSPANLIAARGIFYGMARDAGLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IC81	0.919	0.924	0.000	1518	0.559	0.563	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
2	AFDB:A7KVC2	0.803	0.812	0.000	1510	0.325	0.329	A7KVC2.pdb.gz	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
3	AFDB:B2RX12	0.923	0.925	0.000	1523	0.806	0.808	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
4	AFDB:E7F118	0.914	0.926	0.000	1507	0.490	0.496	E7F118.pdb.gz	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
5	AFDB:G5EFP3	0.911	0.885	0.000	1573	0.435	0.423	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
6	AFDB:O15438	1.000	1.000	0.000	1527	1.000	1.000	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
7	AFDB:O88269	0.875	0.889	0.000	1502	0.408	0.415	O88269.pdb.gz	MRP6_RAT ATP-binding cassette sub-family C member 6 OS=Rattus norvegicus OX=10116 GN=Abcc6 PE=1 SV=1
8	AFDB:O95255	0.893	0.907	0.000	1503	0.425	0.432	O95255.pdb.gz	MRP6_HUMAN ATP-binding cassette sub-family C member 6 OS=Homo sapiens OX=9606 GN=ABCC6 PE=1 SV=2
9	AFDB:P14772	0.852	0.835	0.000	1559	0.329	0.323	P14772.pdb.gz	BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BPT1 PE=1 SV=2
10	AFDB:P33527	0.925	0.922	0.000	1531	0.561	0.560	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
11	PDB:7mpeA	0.798	0.849	6.233E-102	1428	0.374	0.400	7mpeA.pdb.gz
12	PDB:7s5xE	0.679	0.729	7.158E-88	1412	0.302	0.326	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
13	PDB:6jb1B	0.741	0.825	9.274E-88	1366	0.301	0.337	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
14	PDB:7vluA	0.642	0.826	1.772E-87	1159	0.287	0.379	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
15	PDB:6c3pE	0.673	0.748	3.960E-83	1359	0.304	0.341	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
16	PDB:5ykfB	0.738	0.855	9.803E-83	1309	0.297	0.346	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
17	PDB:6c3oE	0.607	0.708	1.305E-78	1290	0.292	0.346	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:7mitE	0.760	0.804	4.759E-75	1438	0.310	0.330	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:6msmA	0.616	0.773	6.519E-70	1181	0.215	0.278	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:5w81A	0.640	0.813	2.030E-67	1173	0.224	0.292	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	1465	1215	0.469	0.589	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	746	1408	0.310	0.336	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	720	1557	0.297	0.292	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	1797	1518	0.566	0.569	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	1402	1492	0.486	0.497	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	701	1582	0.298	0.288	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	699	1582	0.297	0.287	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A7KVC2	793	1510	0.314	0.318	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
9	B2RX12	2551	1523	0.808	0.810	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
10	E1B2R7	644	1426	0.234	0.251	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
11	E7EYG0	649	1426	0.235	0.252	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
12	E7F118	1494	1507	0.492	0.499	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
13	E9Q236	806	1325	0.314	0.362	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
14	F1LR52	777	1288	0.297	0.352	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
15	F1M3J4	805	1325	0.310	0.358	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
16	G5EFP3	1216	1573	0.444	0.431	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
17	I3L4X2	1661	1440	0.537	0.569	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
18	O15438	3138	1527	1.000	1.000	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
19	O15439	809	1325	0.308	0.355	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
20	O15440	635	1437	0.236	0.251	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.5e+02	14.2	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.23	23.3	AAA ATPase domain
3	PF13304 AAA_21	6.9e+02	11.4	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	16	17.2	AAA domain
5	PF13476 AAA_23	3.5e+02	13.1	AAA domain
6	PF13479 AAA_24	8.8e+02	11.0	AAA domain
7	PF13481 AAA_25	22	16.1	AAA domain
8	PF13555 AAA_29	3.8	18.7	P-loop containing region of AAA domain
9	PF12775 AAA_7	41	15.2	P-loop containing dynein motor region
10	PF08298 AAA_PrkA	5.3e+02	10.9	PrkA AAA domain
11	PF09818 ABC_ATPase	16	16.0	ATPase of the ABC class
12	PF00664 ABC_membrane	1.4e-72	256.2	ABC transporter transmembrane region
13	PF00005 ABC_tran	5.4e-48	174.4	ABC transporter
14	PF01712 dNK	4.9e+02	12.0	Deoxynucleoside kinase
15	PF05673 DUF815	7.4e+02	10.6	Protein of unknown function (DUF815)
16	PF01935 DUF87	6.5e+02	11.8	Helicase HerA, central domain
17	PF00350 Dynamin_N	2.9e+02	12.9	Dynamin family
18	PF01926 MMR_HSR1	0.096	24.2	50S ribosome-binding GTPase
19	PF00910 RNA_helicase	53	15.6	RNA helicase
20	PF03193 RsgA_GTPase	0.72	21.2	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377549	0.943	Gastrotropin
2	9606.ENSP00000295897	0.925	Serum albumin
3	9606.ENSP00000256958	0.785	Solute carrier organic anion transporter family member 1B1
4	9606.ENSP00000296327	0.783	Organic solute transporter subunit alpha
5	9606.ENSP00000216540	0.779	Sodium/bile acid cotransporter
6	9606.ENSP00000261196	0.778	Solute carrier organic anion transporter family member 1B3
7	9606.ENSP00000441269	0.772	Solute carrier organic anion transporter family member
8	9606.ENSP00000245539	0.770	Mitochondrial ribosomal protein S7
9	9606.ENSP00000305974	0.734	Solute carrier organic anion transporter family member 1A2
10	9606.ENSP00000289575	0.717	Solute carrier organic anion transporter family member 2B1
11	9606.ENSP00000344155	0.684	ATP-binding cassette sub-family A member 2
12	9606.ENSP00000301645	0.675	Cholesterol 7-alpha-monooxygenase
13	9606.ENSP00000310668	0.672	Nuclear pore complex protein Nup93
14	9606.ENSP00000361666	0.672	Solute carrier family 22 member 7
15	9606.ENSP00000447149	0.668	Bile acid receptor
16	9606.ENSP00000245312	0.661	Ileal sodium/bile acid cotransporter
17	9606.ENSP00000336528	0.655	Nuclear receptor subfamily 1 group I member 2
18	9606.ENSP00000335292	0.648	Organic solute transporter subunit beta
19	9606.ENSP00000318867	0.622	7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
20	9606.ENSP00000217159	0.617	Solute carrier organic anion transporter family member 4A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042910	0.999	xenobiotic transmembrane transporter activity
GO:0140359	0.999	ABC-type transporter activity
GO:0015318	0.998	inorganic molecular entity transmembrane transporter activity
GO:0015125	0.996	bile acid transmembrane transporter activity
GO:0008559	0.994	ABC-type xenobiotic transporter activity
GO:0015103	0.993	inorganic anion transmembrane transporter activity
GO:1901682	0.990	sulfur compound transmembrane transporter activity
GO:0005488	0.987	binding
GO:0005515	0.975	protein binding
GO:0097159	0.795	organic cyclic compound binding
GO:1901363	0.770	heterocyclic compound binding
GO:0036094	0.725	small molecule binding
GO:0043167	0.659	ion binding
GO:0003824	0.626	catalytic activity
GO:1901505	0.595	carbohydrate derivative transmembrane transporter activity
GO:0043168	0.579	anion binding
GO:0043225	0.540	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0015431	0.461	ABC-type glutathione S-conjugate transporter activity
GO:0032553	0.426	ribonucleotide binding
GO:0032555	0.406	purine ribonucleotide binding
GO:0035639	0.355	purine ribonucleoside triphosphate binding
GO:0034040	0.324	ATPase-coupled lipid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.986	establishment of localization
GO:0006810	0.984	transport
GO:0050896	0.976	response to stimulus
GO:0015849	0.965	organic acid transport
GO:0009987	0.963	cellular process
GO:0015711	0.959	organic anion transport
GO:0042221	0.940	response to chemical
GO:0008152	0.896	metabolic process
GO:0046942	0.858	carboxylic acid transport
GO:0010876	0.853	lipid localization
GO:0015718	0.845	monocarboxylic acid transport
GO:0006869	0.835	lipid transport
GO:0044237	0.823	cellular metabolic process
GO:0055085	0.799	transmembrane transport
GO:0071704	0.507	organic substance metabolic process
GO:0051716	0.465	cellular response to stimulus
GO:0065007	0.430	biological regulation
GO:0070887	0.416	cellular response to chemical stimulus
GO:0015850	0.404	organic hydroxy compound transport
GO:0006805	0.370	xenobiotic metabolic process
GO:0015721	0.324	bile acid and bile salt transport
GO:0050789	0.321	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.996	plasma membrane region
GO:0045178	0.965	basal part of cell
GO:0009925	0.962	basal plasma membrane
GO:0016323	0.942	basolateral plasma membrane
GO:0005622	0.715	intracellular anatomical structure
GO:0043227	0.706	membrane-bounded organelle
GO:0005737	0.698	cytoplasm
GO:0043231	0.671	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
EC:7.6.2.2	0.994	ABC-type xenobiotic transporter.
RHEA:19121	0.461	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.461	ABC-type glutathione-S-conjugate transporter.

[back to server]