StarFunc result for job id O15439

User Input

>input (1325 residues)
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
FETAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q6E0	0.965	0.963	0.000	1327	0.691	0.690	A0A2R8Q6E0.pdb.gz
2	AFDB:E7F118	0.887	0.783	0.000	1507	0.350	0.308	E7F118.pdb.gz	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
3	AFDB:E9Q236	0.990	0.990	0.000	1325	0.870	0.870	E9Q236.pdb.gz	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
4	AFDB:O15438	0.888	0.773	0.000	1527	0.346	0.301	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
5	AFDB:O15439	1.000	1.000	0.000	1325	1.000	1.000	O15439.pdb.gz	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
6	AFDB:P91660	0.909	0.877	0.000	1374	0.400	0.386	P91660.pdb.gz	L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster OX=7227 GN=l(2)03659 PE=2 SV=4
7	AFDB:Q42093	0.902	0.739	0.000	1623	0.356	0.291	Q42093.pdb.gz	AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=2
8	AFDB:Q54JR2	0.896	0.843	0.000	1412	0.354	0.332	Q54JR2.pdb.gz	ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcC3 PE=3 SV=1
9	AFDB:Q63120	0.874	0.754	0.000	1541	0.359	0.309	Q63120.pdb.gz	MRP2_RAT ATP-binding cassette sub-family C member 2 OS=Rattus norvegicus OX=10116 GN=Abcc2 PE=1 SV=1
10	AFDB:Q9C8G9	0.895	0.734	0.000	1622	0.353	0.289	Q9C8G9.pdb.gz	AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1
11	PDB:7mpeA	0.781	0.729	6.465E-88	1428	0.365	0.339	7mpeA.pdb.gz
12	PDB:6msmA	0.720	0.797	7.076E-84	1181	0.319	0.358	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
13	PDB:7vluA	0.739	0.834	7.996E-81	1159	0.292	0.334	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
14	PDB:6jb1B	0.801	0.778	7.835E-79	1366	0.297	0.288	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
15	PDB:5w81A	0.725	0.808	1.398E-77	1173	0.320	0.361	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
16	PDB:7s5xE	0.751	0.709	3.498E-77	1412	0.309	0.290	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
17	PDB:5uakA	0.774	0.894	2.287E-76	1139	0.319	0.371	5uakA.pdb.gz	Molecular Structure of the Human CFTR Ion Channel.
18	PDB:5ykfB	0.789	0.799	1.724E-74	1309	0.297	0.300	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
19	PDB:6c3pE	0.735	0.718	1.402E-73	1359	0.304	0.297	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
20	PDB:5uarA	0.776	0.862	5.671E-73	1184	0.320	0.358	5uarA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	828	1215	0.354	0.386	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	1137	1408	0.454	0.427	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	655	1557	0.333	0.283	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	850	1518	0.362	0.316	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	762	1492	0.349	0.310	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	625	1582	0.334	0.280	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	624	1582	0.334	0.280	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	710	1396	0.337	0.319	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	759	1510	0.354	0.311	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RUS7	612	1588	0.337	0.281	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	B2RX12	825	1523	0.355	0.309	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	E1B2R7	667	1426	0.270	0.251	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
13	E7EYG0	674	1426	0.272	0.253	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
14	E7F118	823	1507	0.362	0.318	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
15	E9Q236	2390	1325	0.871	0.871	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
16	F1LR52	2305	1288	0.845	0.869	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
17	F1M3J4	2385	1325	0.866	0.866	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
18	G5EE72	633	1427	0.317	0.294	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
19	G5EFP3	813	1573	0.379	0.319	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
20	I3L4X2	858	1440	0.384	0.353	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	97	14.8	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.0028	29.6	AAA ATPase domain
3	PF13304 AAA_21	0.015	26.7	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	1.7	20.3	AAA domain
5	PF13476 AAA_23	8.6	18.4	AAA domain
6	PF13514 AAA_27	5e+02	11.7	AAA domain
7	PF13555 AAA_29	0.0015	29.6	P-loop containing region of AAA domain
8	PF13604 AAA_30	3.1	19.0	AAA domain
9	PF12775 AAA_7	19	16.3	P-loop containing dynein motor region
10	PF09818 ABC_ATPase	2.3e+02	12.2	ATPase of the ABC class
11	PF00664 ABC_membrane	1.7e-73	259.2	ABC transporter transmembrane region
12	PF00005 ABC_tran	2.1e-52	188.7	ABC transporter
13	PF02492 cobW	1.5e+02	13.3	CobW/HypB/UreG, nucleotide-binding domain
14	PF19993 DO-GTPase2	7.6	17.8	Double-GTPase 2
15	PF05673 DUF815	3.5e+02	11.7	Protein of unknown function (DUF815)
16	PF01935 DUF87	2e+02	13.5	Helicase HerA, central domain
17	PF00350 Dynamin_N	0.71	21.4	Dynamin family
18	PF01926 MMR_HSR1	0.00041	31.8	50S ribosome-binding GTPase
19	PF00931 NB-ARC	1.2e+02	13.3	NB-ARC domain
20	PF03193 RsgA_GTPase	0.0061	28.0	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337335	0.846	Solute carrier family 22 member 8
2	9606.ENSP00000245539	0.813	Mitochondrial ribosomal protein S7
3	9606.ENSP00000394485	0.780	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
4	9606.ENSP00000256958	0.732	Solute carrier organic anion transporter family member 1B1
5	9606.ENSP00000289575	0.719	Solute carrier organic anion transporter family member 2B1
6	9606.ENSP00000216540	0.715	Sodium/bile acid cotransporter
7	9606.ENSP00000261196	0.715	Solute carrier organic anion transporter family member 1B3
8	9606.ENSP00000441269	0.715	Solute carrier organic anion transporter family member
9	9606.ENSP00000301732	0.707	ATP-binding cassette sub-family A member 3
10	9606.ENSP00000361666	0.702	Solute carrier family 22 member 7
11	9606.ENSP00000305974	0.701	Solute carrier organic anion transporter family member 1A2
12	9606.ENSP00000296327	0.699	Organic solute transporter subunit alpha
13	9606.ENSP00000367102	0.699	Solute carrier family 22 member 6
14	9606.ENSP00000270570	0.698	Multidrug and toxin extrusion protein 1
15	9606.ENSP00000301891	0.694	Solute carrier family 22 member 11
16	9606.ENSP00000357836	0.694	Sorting nexin-27
17	9606.ENSP00000296577	0.691	ATP-binding cassette sub-family E member 1
18	9606.ENSP00000279178	0.677	Solute carrier family 22 member 9
19	9606.ENSP00000378920	0.662	Solute carrier family 26 member 6
20	9606.ENSP00000311291	0.658	Solute carrier organic anion transporter family member 2A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015562	0.998	efflux transmembrane transporter activity
GO:0042626	0.996	ATPase-coupled transmembrane transporter activity
GO:0005488	0.986	binding
GO:0005515	0.966	protein binding
GO:0015103	0.955	inorganic anion transmembrane transporter activity
GO:0005319	0.954	lipid transporter activity
GO:0140359	0.954	ABC-type transporter activity
GO:0008514	0.953	organic anion transmembrane transporter activity
GO:0046943	0.940	carboxylic acid transmembrane transporter activity
GO:0042910	0.906	xenobiotic transmembrane transporter activity
GO:1901682	0.817	sulfur compound transmembrane transporter activity
GO:0015932	0.744	nucleobase-containing compound transmembrane transporter activity
GO:0015125	0.737	bile acid transmembrane transporter activity
GO:0015216	0.667	purine nucleotide transmembrane transporter activity
GO:0097159	0.641	organic cyclic compound binding
GO:1901363	0.640	heterocyclic compound binding
GO:1901702	0.504	salt transmembrane transporter activity
GO:0036094	0.418	small molecule binding
GO:0043225	0.367	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0015431	0.358	ABC-type glutathione S-conjugate transporter activity
GO:0071714	0.341	icosanoid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.982	localization
GO:0006810	0.972	transport
GO:0009987	0.968	cellular process
GO:0042908	0.792	xenobiotic transport
GO:0071702	0.770	organic substance transport
GO:0050896	0.767	response to stimulus
GO:0042221	0.651	response to chemical
GO:0065007	0.617	biological regulation
GO:0055085	0.612	transmembrane transport
GO:0015711	0.479	organic anion transport
GO:0050789	0.408	regulation of biological process
GO:0008152	0.397	metabolic process
GO:0051716	0.379	cellular response to stimulus
GO:0050794	0.357	regulation of cellular process
GO:0044237	0.353	cellular metabolic process
GO:0046942	0.347	carboxylic acid transport
GO:0071704	0.346	organic substance metabolic process
GO:0006869	0.337	lipid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0098590	0.859	plasma membrane region
GO:0016324	0.729	apical plasma membrane
GO:0043231	0.717	intracellular membrane-bounded organelle
GO:0005737	0.698	cytoplasm
GO:0009925	0.545	basal plasma membrane
GO:0016323	0.536	basolateral plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.996	Translocases.
RHEA:19121	0.358	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.358	ABC-type glutathione-S-conjugate transporter.

[back to server]