StarFunc result for job id O15440

User Input

>input (1437 residues)
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLS
LDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLAR
VAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTW
ALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNE
VLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSG
KTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNS
CCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETS
VSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPM
KFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGP
LVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQEL
LDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLT
GLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEM
RYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLE
SEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCT
MLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EYG0	0.882	0.889	0.000	1426	0.732	0.738	E7EYG0.pdb.gz	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
2	AFDB:G5EE72	0.817	0.822	0.000	1427	0.345	0.348	G5EE72.pdb.gz	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
3	AFDB:O15440	1.000	1.000	0.000	1437	1.000	1.000	O15440.pdb.gz	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2
4	AFDB:Q80WJ6	0.828	0.870	0.000	1366	0.422	0.444	Q80WJ6.pdb.gz	MRP9_MOUSE ATP-binding cassette sub-family C member 12 OS=Mus musculus OX=10090 GN=Abcc12 PE=1 SV=1
5	AFDB:Q96J65	0.851	0.899	0.000	1359	0.424	0.449	Q96J65.pdb.gz	MRP9_HUMAN ATP-binding cassette sub-family C member 12 OS=Homo sapiens OX=9606 GN=ABCC12 PE=1 SV=2
6	AFDB:Q96J66	0.847	0.880	0.000	1382	0.390	0.406	Q96J66.pdb.gz	MRP8_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens OX=9606 GN=ABCC11 PE=1 SV=1
7	AFDB:A0A2R8Q6E0	0.789	0.852	1.946E-103	1327	0.315	0.341	A0A2R8Q6E0.pdb.gz
8	AFDB:A0A0R4IC81	0.816	0.774	1.817E-102	1518	0.317	0.300	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
9	AFDB:Q54JR2	0.752	0.764	2.272E-102	1412	0.338	0.344	Q54JR2.pdb.gz	ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcC3 PE=3 SV=1
10	AFDB:Q63120	0.813	0.760	3.398E-102	1541	0.333	0.310	Q63120.pdb.gz	MRP2_RAT ATP-binding cassette sub-family C member 2 OS=Rattus norvegicus OX=10116 GN=Abcc2 PE=1 SV=1
11	PDB:7mpeA	0.659	0.663	9.315E-84	1428	0.312	0.314	7mpeA.pdb.gz
12	PDB:7vluA	0.743	0.912	1.218E-83	1159	0.275	0.341	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
13	PDB:7s5xE	0.750	0.763	6.640E-79	1412	0.282	0.287	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:6jb1B	0.708	0.742	1.698E-78	1366	0.277	0.291	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
15	PDB:5ykfB	0.702	0.766	4.533E-76	1309	0.282	0.309	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6c3pE	0.749	0.790	8.104E-76	1359	0.278	0.294	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6c3oE	0.710	0.786	7.233E-73	1290	0.273	0.305	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:6msmA	0.721	0.864	5.399E-70	1181	0.229	0.279	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
19	PDB:5w81A	0.725	0.877	1.842E-66	1173	0.231	0.283	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
20	PDB:7mitE	0.726	0.725	5.149E-66	1438	0.282	0.282	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	672	1215	0.260	0.307	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	704	1408	0.312	0.319	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	653	1557	0.290	0.268	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	658	1518	0.248	0.235	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	620	1492	0.251	0.241	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	624	1582	0.310	0.281	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	624	1582	0.310	0.281	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	708	1396	0.320	0.330	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	652	1510	0.317	0.301	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RUS7	600	1588	0.305	0.276	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	B2RX12	635	1523	0.251	0.237	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	E1B2R7	2158	1426	0.731	0.737	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
13	E7EYG0	2176	1426	0.738	0.743	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
14	E7F118	719	1507	0.315	0.300	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
15	E9Q236	688	1325	0.264	0.287	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
16	F1LR52	682	1288	0.268	0.299	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
17	F1M3J4	672	1325	0.265	0.288	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
18	G5EE72	909	1427	0.348	0.350	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
19	G5EFP3	689	1573	0.319	0.291	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
20	I3L4X2	671	1440	0.260	0.259	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	7.2	18.4	AAA ATPase domain
2	PF13238 AAA_18	2.2e+02	13.8	AAA domain
3	PF13304 AAA_21	1.6e+02	13.4	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13476 AAA_23	3.3	19.7	AAA domain
5	PF13479 AAA_24	61	14.8	AAA domain
6	PF13555 AAA_29	0.38	21.9	P-loop containing region of AAA domain
7	PF12775 AAA_7	4.8e+02	11.7	P-loop containing dynein motor region
8	PF00664 ABC_membrane	1.6e-48	177.3	ABC transporter transmembrane region
9	PF00005 ABC_tran	1.3e-49	179.7	ABC transporter
10	PF02492 cobW	2.4e+02	12.7	CobW/HypB/UreG, nucleotide-binding domain
11	PF19993 DO-GTPase2	3.4e+02	12.4	Double-GTPase 2
12	PF00350 Dynamin_N	16	17.0	Dynamin family
13	PF01926 MMR_HSR1	3.3	19.2	50S ribosome-binding GTPase
14	PF03193 RsgA_GTPase	21	16.4	RsgA GTPase
15	PF02463 SMC_N	2.2e-07	42.1	RecF/RecN/SMC N terminal domain
16	PF02367 TsaE	70	14.8	Threonylcarbamoyl adenosine biosynthesis protein TsaE
17	PF06414 Zeta_toxin	2.8e+02	12.2	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333926

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245539	0.820	Mitochondrial ribosomal protein S7
2	9606.ENSP00000222388	0.686	ATP binding cassette subfamily F member 2
3	9606.ENSP00000354995	0.638	ATP-binding cassette sub-family G member 1
4	9606.ENSP00000361666	0.611	Solute carrier family 22 member 7
5	9606.ENSP00000289575	0.605	Solute carrier organic anion transporter family member 2B1
6	9606.ENSP00000377424	0.605	Equilibrative nucleoside transporter 1
7	9606.ENSP00000328118	0.594	Probable guanine nucleotide exchange factor MCF2L2
8	9606.ENSP00000365413	0.576	Solute carrier family 28 member 3
9	9606.ENSP00000481728	0.571	ATP-binding cassette sub-family G member 4
10	9606.ENSP00000305974	0.566	Solute carrier organic anion transporter family member 1A2
11	9606.ENSP00000350024	0.559	Equilibrative nucleoside transporter 2
12	9606.ENSP00000337335	0.554	Solute carrier family 22 member 8
13	9606.ENSP00000346827	0.549	4-trimethylaminobutyraldehyde dehydrogenase
14	9606.ENSP00000378074	0.549	Sodium/nucleoside cotransporter 1
15	9606.ENSP00000256958	0.546	Solute carrier organic anion transporter family member 1B1
16	9606.ENSP00000313603	0.530	ATP-binding cassette sub-family F member 1
17	9606.ENSP00000279178	0.525	Solute carrier family 22 member 9
18	9606.ENSP00000245407	0.523	Solute carrier family 22 member 5
19	9606.ENSP00000362795	0.519	C-X-C chemokine receptor type 3
20	9606.ENSP00000354483	0.518	Inactive dual specificity phosphatase 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.999	ABC-type transporter activity
GO:1901505	0.998	carbohydrate derivative transmembrane transporter activity
GO:0005488	0.997	binding
GO:0005515	0.973	protein binding
GO:0042910	0.965	xenobiotic transmembrane transporter activity
GO:0008559	0.957	ABC-type xenobiotic transporter activity
GO:0015103	0.952	inorganic anion transmembrane transporter activity
GO:0043167	0.891	ion binding
GO:0008514	0.891	organic anion transmembrane transporter activity
GO:0015562	0.822	efflux transmembrane transporter activity
GO:1901363	0.811	heterocyclic compound binding
GO:0022884	0.788	macromolecule transmembrane transporter activity
GO:0015605	0.770	organophosphate ester transmembrane transporter activity
GO:0015932	0.766	nucleobase-containing compound transmembrane transporter activity
GO:0097159	0.734	organic cyclic compound binding
GO:0015216	0.679	purine nucleotide transmembrane transporter activity
GO:0015232	0.668	heme transmembrane transporter activity
GO:0043168	0.590	anion binding
GO:0043225	0.531	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0000166	0.406	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.955	metabolic process
GO:0009987	0.947	cellular process
GO:0071704	0.942	organic substance metabolic process
GO:0050896	0.901	response to stimulus
GO:1901564	0.879	organonitrogen compound metabolic process
GO:0006810	0.855	transport
GO:0042221	0.853	response to chemical
GO:0071702	0.765	organic substance transport
GO:0055085	0.755	transmembrane transport
GO:0009058	0.642	biosynthetic process
GO:0043170	0.642	macromolecule metabolic process
GO:1901576	0.621	organic substance biosynthetic process
GO:0006022	0.616	aminoglycan metabolic process
GO:0044237	0.602	cellular metabolic process
GO:1903510	0.596	mucopolysaccharide metabolic process
GO:0006024	0.566	glycosaminoglycan biosynthetic process
GO:0065007	0.478	biological regulation
GO:0071705	0.474	nitrogen compound transport
GO:0044238	0.443	primary metabolic process
GO:0015711	0.364	organic anion transport
GO:0050789	0.333	regulation of biological process
GO:0015849	0.332	organic acid transport
GO:0046942	0.314	carboxylic acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.999	plasma membrane region
GO:0045178	0.990	basal part of cell
GO:0009925	0.984	basal plasma membrane
GO:0016323	0.967	basolateral plasma membrane
GO:0005622	0.905	intracellular anatomical structure
GO:0045177	0.869	apical part of cell
GO:0016324	0.844	apical plasma membrane
GO:0043226	0.783	organelle
GO:0043227	0.646	membrane-bounded organelle
GO:0005737	0.642	cytoplasm
GO:0043231	0.565	intracellular membrane-bounded organelle
GO:0012505	0.337	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
EC:7.6.2.2	0.957	ABC-type xenobiotic transporter.

[back to server]